SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 504474.cur_1628 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  504474.cur_1628
Domain Number 1 Region: 76-137
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000183
Family NfeD domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 504474.cur_1628
Sequence length 139
Comment (Corynebacterium urealyticum DSM 7109)
Sequence
MIWFIAALVLAGLELAAGEFTLLMLAGGATVGGLVEWAGAPTWAAIVAFGIATAGLILFL
RPILRRRLHGPKALDTSQQALVGATAEVLEDVGARSGQIRLDGSIWSARSMDPSETFTRG
EEVHVIDIDGPTAVVWKRE
Download sequence
Identical sequences B1VIK4
504474.cur_1628 WP_012360864.1.62580 WP_012360864.1.83933 gi|448824234|ref|YP_007417403.1| gi|172041308|ref|YP_001801022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]