SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 504832.OCAR_4926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  504832.OCAR_4926
Domain Number - Region: 88-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0157
Family NfeD domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 504832.OCAR_4926
Sequence length 145
Comment (Oligotropha carboxidovorans OM5)
Sequence
MIDLAIKLGSWNWLILGVLLMGIEALAPGVFMLWLGLAALIVGLLSFLFVASWQMQVVAF
ALISIAMVPLWRHFARREAVDNNFLNRRTKGLVGQVVTLESAIVDGVGSIRLGDTTWRVE
GPPLAAGTKVRIVEADGARLRVGPA
Download sequence
Identical sequences B6JAY9
WP_012562093.1.10663 WP_012562093.1.50963 WP_012562093.1.53695 gi|386031193|ref|YP_005951968.1| gi|337742228|ref|YP_004633956.1| gi|337742228|ref|YP_004633956.1| 504832.OCAR_4926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]