SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5057.CADACLAP00007565 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5057.CADACLAP00007565
Domain Number 1 Region: 648-883
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.2e-68
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.00096
Further Details:      
 
Domain Number 2 Region: 885-1045
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.49e-36
Family NADPH-cytochrome p450 reductase-like 0.001
Further Details:      
 
Domain Number 3 Region: 403-645
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-34
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00045
Further Details:      
 
Domain Number 4 Region: 250-348
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.41e-19
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5057.CADACLAP00007565
Sequence length 1045
Comment (Aspergillus clavatus)
Sequence
MGSSSPSLSALGGPTYVTAQTLIQQVAYLLSDKIFSYSPESFDLDNAVREWASRQETNAN
GESPAVKAMETRQGAGNIALGYLFSQDFDLKKRHVPQGIVASSATLPYMRSALEQLSLLY
SVASPVAAHVAAVDYAGEDGLVSDYSSALSLAEELGLALVSSASVHEAQHMALFTTLLAS
ILPSVHIYDGVRVGRENTRVIDVLDQAGVARSYETIRKTLDESRSRHLDTQGKLLDLLKS
LNGELGTDYGLFEYSGHAEPLSVLVAFGTVEASLTAQVARSLAKDGVRVGVINVRVYRPF
VEEEFLRVLPQSTKTVGVLGQVANEQAVQEQGVRSALYEDVLAALTFAAGREQAPTCVDI
KYPRSQRWNLINTAAAFQLISEKPIVQVDGESAPLQLIDPVTVQEYTFWDVDSSACESAA
ATLSEALAADSASNVTTTKSHDNFVQGGTVRIDIRKSSKILDAPYAITAADTVYVGEPKL
LQDIDIAASVKDNGKVIINAPGVKDEDLEKKLPAAFRQAAAQRGISLYIVDPSAAGDASL
ESVVLQSAFLRVALPSQEGVGIKKLSSIISNPEALENVSKDLDKLLRQIEIPESWKESEE
APQASQLPKDISINSFVPFDKNEAEPAPILADWQAAAKALAFKEAYGTKTALRPETATKT
FTVHVKENRRLTPVTYDRNIFHIEFDLGDSGLKYDIGEALGVHAENDPQDVSEFIKFYGL
NPDDVVSVPSREDPTVLESRTVYQALVQNLDIFGRPPKRFYEALAEFASDEKEKTDLLTL
GGPEGAVEFKRRAEVDTITFADVLLEYPSAHPDFHDLIRIVGPMKRREYSIASCQKVTPS
TVALMIVAVNWVDPNGRDRFGLATRYLSRLQPGTPVTVSVKSSVMKLPPKSTQPLIMAGL
GTGLAPFRAFVQHRALEKAQGKEIGSVLLYMGSRHQREEYCYGEEWEAYQEAGVITLLGR
AFSRDQPEKIYIQDRMRESISDIVQAYIREEGAFYLCGPTWPVPDVTAVLEEAIAIEAKN
NGKKVDTRKEIEKLKDEERYVLEVY
Download sequence
Identical sequences A1CTL6
5057.CADACLAP00007565 XP_001268079.1.35617 ACLA_083480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]