SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00001872 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00001872
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-20
Family Extended AAA-ATPase domain 0.00011
Further Details:      
 
Domain Number 2 Region: 124-213
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.79e-19
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00001872
Sequence length 228
Comment (Aspergillus flavus)
Sequence
MALRRIMEKYTANTRFCIIANYTHKLSPALLSRCTRFRFSPLKEQDIRSLVDLVIEKEEV
KIQPEAVDSLVKLSKGDMRRALNVLQACHASSIPLPVKNAPKDQPRPEPELITNGTIYDC
IAAPHPADIQEIMTTLLATSDVTSCLSTVNTLKSNKGLALADILAALGEQLQQLEVPAQT
RITWLEGLAEIEFRLAGGGSEAIQTGGLVGVVRNGCELMGDKGVSMAS
Download sequence
Identical sequences B8N2X2
AFL2T_01731 5059.CADAFLAP00001872 XP_002374007.1.25037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]