SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00004218 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00004218
Domain Number 1 Region: 7-146
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.24e-24
Family Regulator of G-protein signaling, RGS 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00004218
Sequence length 282
Comment (Aspergillus flavus)
Sequence
MKSKSKTLYHLRPKLDEILNDTAPVPYTLGTFIAFLAQNHCLEVLEFILEAKRYRKTYDW
LQDHGKACGEDGAHEERLRTVWDRIIDTYIESGAPREINVPNETREELLEYTKTNDSIPP
PSLLDNAVQHMHELLRESILIPFLRSCSGTSHVQPLSVPCLSGTERLSPSPRASDDTARR
RSKLSGLIPSSPADMYSSDGSEPPTRCISRDTSSQGPPGSSSSEIAREITGGQDWDVLPN
GVGAEMWHANTAPERKRRSPESPKKRWPRLHGFTKHFRRSSD
Download sequence
Identical sequences B8N7N8
XP_002376353.1.25037 AFL2T_03948 5059.CADAFLAP00004218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]