SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5061.CADANGAP00002005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5061.CADANGAP00002005
Domain Number 1 Region: 8-136
Classification Level Classification E-value
Superfamily UBC-like 1.32e-28
Family UBC-related 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5061.CADANGAP00002005
Sequence length 153
Comment (Aspergillus niger)
Sequence
MFAGKRLSKMKDHLPPGITIVKSENLEEWQMDIKVLDSNPLYQNETYRLKFTFSNKYPIE
PPEVQFIECPPTSDHPRPIPVHPHIYSNGIICLDLLSSAGWSPVQTVESVCMSIQSMLTA
NSRNERPPGDSEFVSYNRRRPRDINFHYDDDNV
Download sequence
Identical sequences A2QD15
CADANGAP00002005 5061.CADANGAP00002005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]