SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5061.CADANGAP00008827 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5061.CADANGAP00008827
Domain Number 1 Region: 648-883
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.97e-65
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 885-1045
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.67e-36
Family NADPH-cytochrome p450 reductase-like 0.0014
Further Details:      
 
Domain Number 3 Region: 403-645
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00066
Further Details:      
 
Domain Number 4 Region: 250-348
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.01e-19
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5061.CADANGAP00008827
Sequence length 1045
Comment (Aspergillus niger)
Sequence
MGSPSPALSTLGGPTYVTAQTLIQQVAYVLNDKIFSYSPESFDLDAALREWSSKQEINAN
GDSPEIKAMETRQGAGNIALGYIFSQDFDLKKRHIPQGIVASSATLPYMRAALEQLSLLY
SVASPVAAHVAAVDYAGEDGLVSDYASALSLAEELGLGLVSSASVHESQHMALLTTLLSS
VLPSVHIYDGVRVGREETRVIDVLDQAGLSRTYEAVRKTLEDSRSRHLDTQGKLLELLQS
LNGELGTDYGLFEYHGHAEPVSVLVAFGTVEASLTAQIARSLAKDGVRVGVINVRVYRPF
VEEEFLRVLPKSVKTVGVLGQVSDEQAVQEQGVRSALYEDVLAALTFATDREQTPACIDI
KYARSQRWDLINTAAAFQLVHEKPIVQAGAESEALQLLDPATVQEYTFWDVDNSVGGDVA
TTLSQALAADSASNVTTNKVHDNLVQGGVVRVDIRKSSKIVDAPYSITAADTAYVGDVKL
LGDVDIAASVKDNGKVIVNAPGVKDDELEKKLPVAFRQAVAQRGISLYFVDPSVAGETAS
ESSVLQVAFLRVALPSQESVGIKKLASIGGNAEALENVSKELEKVLRQIEVPEAWKTPEE
GAQVAQLPKDISPNSFVSFDKEESEPATYLKDWQTAAKGLAFKEAYGTKNALRPETATKT
FTVHVKENRRLTPVTYDRNIFHIEFDLGDSGLKYDIGEALGVHAENDPKDVMDFIAFYGL
NADDVVEVPSREDPAVLENRTVYQALVQNVDIFGRPPKRFYEALAEFADDEKEKTDLLTL
GGPDGAVEFKRRSEVDTVTFADILLQYPSAKPDFHELIRIVGPLKRREYSIASCQKVTPT
TVALMIVAVTWSDPTGRDRFGLATRYLSRLQPGTPVTVSVKSSVMKLPPKSTQPLIMAGL
GTGLAPFRAFVQHRALEKAQGKEIGAVLLYMGSRHQREEYCYGEEWEAYQEAGVITVLGR
AFSRDQPEKIYIQDRMRQTLPEIIQAYIREEGAFYLCGPTWPVPDVTAVLEEAIATEAKN
LGKKVDSRKEIEKLKDEERYVLEVY
Download sequence
Identical sequences A2QWW2
XP_001394645.1.80561 CADANGAP00008827 5061.CADANGAP00008827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]