SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5061.CADANGAP00008850 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5061.CADANGAP00008850
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily UBC-like 1e-47
Family UBC-related 0.00000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5061.CADANGAP00008850
Sequence length 184
Comment (Aspergillus niger)
Sequence
MSSPKRRIETDVMKLMSDYEVTLVNDNRQEFYVRFKGPEETPFAGGHWKIHVELPDQYPY
KSPSIGFVNRIFHPNIDELSGSVCLDVINQTWSPMYDMINIFEVFLPQLLRYPNPSDPLN
GEAAAMLMREPKSYEAKVKEYVAKYASKEAVDEAGEDTESEDELSSAGSYESGGEEPAGT
MDDV
Download sequence
Identical sequences A2QWY5
CADANGAP00008850 5061.CADANGAP00008850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]