SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5062.CADAORAP00000514 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5062.CADAORAP00000514
Domain Number 1 Region: 648-883
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.41e-66
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 885-1045
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.07e-36
Family NADPH-cytochrome p450 reductase-like 0.0016
Further Details:      
 
Domain Number 3 Region: 403-645
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.44e-30
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0011
Further Details:      
 
Domain Number 4 Region: 250-362
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.01e-18
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5062.CADAORAP00000514
Sequence length 1045
Comment (Aspergillus oryzae)
Sequence
MASSSPALSALEGPTYVTAQTLIQQVAYVLSDKIFSYSPESFDLDAALKQWASSQESNAN
GETPAIQAMETRQGAGNIALGYLFSQDFDLKKRHVPQGIVASSATLPYMRTALEQLSLLY
SVASPVAAHVAAVDYAGEEGLVSDYASALSLAEELGLGLVSSASVHESQHMALLTTLLAS
VLPSVHIYDGVRVGRETTRVIDVLSQAGLSRTYEAVRKTLEDSRSRHLDTQGKLLELLQS
LNGELGTDYGLFEYHGHVEPVSVLVAFGTVEASLTAQIARSLAKDGVRVGVINVRVYRPF
VEEEFLRVLPQSVKTVGVLGQVANEQAVQEQGVRSALYEDVLAALTFATGRENVPTCVDI
KYARSQRWDLINTAAAFQLISEKPIVQTNGQTVPLQLLDPSAVQEYIFWDVDTSACDNAA
AALSQALAADSASNVTTNKTHDNLVQGGVVRIDIRKSSKTLEAPYAITAANTAYVGDIKL
LADIDIAASVQNNGNLIINAPGVKDEDLEKKLPVAFRQQVAERGISLYIVDPSVTGDESL
DSVVLQTAFLRVALPSLEEVGLKKLGSITGNVESLENVSKDLDKLLRQIEIPEAWKTPEE
GFEAPQLPKDISPNSFVSFDKEDSEPASLLKDWQTAAKGLAFKEAYGTKTALRPDTAAKT
FTVHVKENRRLTPVTYDRNIFHIEFDLGDSGLTYDIGEALGVHAENDVKEVSDFIAFYGL
NADDIVEVPSREDPAVLENRTVFQALTQNVDIFGRPPKRFYEALAEFATDEKEKTDLLTL
GGPEGAVEFKRRSEVDTVTYADILLEYPSAHPEFHDLIRIVGPLKRREYSIASCQKVTPN
SVALMIVAVNWVAPNGRDRFGLATRYLSRLQPGSPITVSVKSSVMKLPPKSTQPIIMAGL
GTGLAPFRAFVQHRALEKAQGKEIGAVLLYMGSRHQREEYCYGEEWEAYQEAGVITLLGR
AFSRDQPEKIYIQDRMRQTLPEIVDAYIREEGSFYLCGPTWPVPDVTAVLEEAIAIEAKA
NGKKVDTRREIEKLKDEERYVLEVY
Download sequence
Identical sequences A0A0D9MWU8 A0A1S9D6C2 Q2UMY5
AO090001000571 XP_001819082.1.101437 5062.CADAORAP00000514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]