SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 507522.KPK_4215 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  507522.KPK_4215
Domain Number 1 Region: 107-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000196
Family NfeD domain-like 0.0048
Further Details:      
 
Weak hits

Sequence:  507522.KPK_4215
Domain Number - Region: 27-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00366
Family LacY-like proton/sugar symporter 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 507522.KPK_4215
Sequence length 152
Comment (Klebsiella pneumoniae 342)
Sequence
MIDMIFAHPHLFWLSLGGLLLAAEMLGGSGYLLWSGVAGVVTGALTWLLPLNWEWQGTLF
AVLTLLAAWLWSKWLRKRVKTQRPADAQLNQRGQQLVGRRLTLDAPLVNGRGHVRVGDSS
WPVIADEDLAAGSKVEVIAVEGITLRIRPAVR
Download sequence
Identical sequences B5Y0M3
WP_012542657.1.6018 507522.KPK_4215 gi|206579238|ref|YP_002240014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]