SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 508765.CLL_A0874 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  508765.CLL_A0874
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.82e-30
Family Anti-sigma factor antagonist SpoIIaa 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 508765.CLL_A0874
Sequence length 111
Comment (Clostridium botulinum B Eklund 17B)
Sequence
MDLKFDKYDEILIVTMIGELDHHSAEEVRVRIDDRIDRDNIQKLILNFSGVSFMDSSGIG
VVVARNKKLSNKGGNLCICNIKESVNKVFELTGLYKIIKHYETVDEAVRCI
Download sequence
Identical sequences A0A0M0A9Q0 B2TLY0
gi|187933243|ref|YP_001885075.1| WP_012423466.1.40399 WP_012423466.1.45387 WP_012423466.1.49945 WP_012423466.1.50906 WP_012423466.1.54004 WP_012423466.1.55913 WP_012423466.1.88993 508765.CLL_A0874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]