SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 508765.CLL_A1090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  508765.CLL_A1090
Domain Number 1 Region: 82-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000418
Family NfeD domain-like 0.0045
Further Details:      
 
Weak hits

Sequence:  508765.CLL_A1090
Domain Number - Region: 8-66
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00902
Family LacY-like proton/sugar symporter 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 508765.CLL_A1090
Sequence length 147
Comment (Clostridium botulinum B Eklund 17B)
Sequence
MGSIVFWIIVAVAAFVIDIFTSSFLFVWFSIGALTAIFAAGLKATFLIQVIIFLIVGIIS
ISIGYPWIRKKYKNSEHRVPLMEETYIGKVITAEENIDQKATLKINGIYWTVVNEGEHIH
AGERFIITSIDGAKFRIKKLEGENKNV
Download sequence
Identical sequences B2TN58
gi|187933275|ref|YP_001885288.1| 508765.CLL_A1090 WP_012423498.1.45387 WP_012423498.1.55913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]