SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 508765.CLL_A2353 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  508765.CLL_A2353
Domain Number 1 Region: 789-1169
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.15e-129
Family PFOR PP module 0.00000000379
Further Details:      
 
Domain Number 2 Region: 415-669
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-86
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000113
Further Details:      
 
Domain Number 3 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.55e-75
Family PFOR Pyr module 0.0000000249
Further Details:      
 
Domain Number 4 Region: 258-412
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.04e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.000018
Further Details:      
 
Domain Number 5 Region: 671-834
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.77e-20
Family Ferredoxin domains from multidomain proteins 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 508765.CLL_A2353
Sequence length 1171
Comment (Clostridium botulinum B Eklund 17B)
Sequence
MRKTKTMDGNTAAAHISYGFTEVAAIYPITPSSPMAEHVDEWASQGRKNIFGEPVKMVEM
QSEAGAAGAMHGSLQAGALTTTYTASQGLLLMIPNMYKIAGEKLPCVMHVSARALAASSL
SIFGDHQDVMAVRQTGFAMLAETSVQEVMDLSGVAHLAAIKGKIPFVNFFDGFRTSHEIQ
KIEVIEQDELAKLVDYNAIDEFRKNALSPNHPVTRGTAQNPDIYFQTREAVNKAYDDIPY
IVEEYMSEITKLTGREYHCFDYYGAKDADRIIISMGSINDVVEETVDYLNNNKQKVGLVK
VRLYRPFSVERLLKVIPESVKKIAVLDRTKEPGAIGEPLYLDVVRCLYGKKDAPIIVGGR
FGLGSKDPTPSHIAAVFDNLISDEPKNQFTIGITDDLTNTSLKLHEDINATPEGTTSCKF
WGLGSDGTVGANKSAIKIIGDHTDMYAQGYFDYDSKKSGGITVSHLRFGKELIKSRYLID
KADFIACHNQSYVYKYNVLKGLKKNARFLLNTIWDKDELEEKLPASMKKFIAENDIEFYT
INAIKIAQEIGLGGRINMIMQAAFFKITNIIPVEDAVKYLKEAVVNSYGKKGEKVVRMNH
DAIEAGVEGVVKIEIPAGWKNTIDDKKECNKDLPAFIREIVNPMNRLEGDSLPVSTFVKH
NLEDGTFMAGTTAYEKRGIAVNVPEWLQDKCIQCNQCSYVCPHATIRPFLLNEEEKLKAP
SSIKLIEPKALKSDEKLYYSIGVTPLDCTGCGNCVEVCPAPGKALIMKPQASQHDQIEVW
DYTVEKVNKKNPMNKNTVKGSQFETPLLEYSGACAGCGETPYAKLITQLFGDRMMIANAT
GCSSIWASGAPATAYTKNQQGHGPAWANSLFEDNAEFGYGMHLGVKAIRERIAHNIEAAL
NSNISENTKEVLKDWLDHKDCSEGTRDRSNKVIEVLEKENNELAKVILKDKEFLVNRSQW
IFGGDGWSYDIGYGGLDHVIASGENVNIFIFDTEIYSNTGGQASKSTPTAAIAKFAASGK
RTKKKDLGMIAMTYGYVYVAQIAMGADKNQTLKAICEAESYDGPSLIIAYAPCISHGIKI
GMSNSQEEEKKAVECGYWSLYRYNPILKGSKNPFSLDSKEPKGNFREFLMGEVRYSSLVK
VFPELSEELFKKTEEDAIERYNNYKKLASQE
Download sequence
Identical sequences B2TRW8
gi|187934157|ref|YP_001886542.1| 508765.CLL_A2353 WP_012424341.1.45387 WP_012424341.1.55913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]