SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 509169.xccb100_0206 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  509169.xccb100_0206
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily GlnB-like 4.77e-46
Family Prokaryotic signal transducing protein 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 509169.xccb100_0206
Sequence length 114
Comment (Xanthomonas campestris B100)
Sequence
MRMKLITAIIRPFKLDEVREALSAAGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPK
IKIETVVTDDRLDAVVEAIQNAAGTGKIGDGKIFVTAIEQVVRIRTGEIGADAL
Download sequence
Identical sequences A0A0H2X308 B0RLV0 D4SZA7 D4TB57 F0C215 F1W5C2 G0CM06 Q7BP84 Q7CLW3 Q9RBK0 W4SA96 W4SNP7
190485.XCC0186 190486.XAC0205 314565.XC_0195 509169.xccb100_0206 NP_635581.1.47755 gi|384429956|ref|YP_005639317.1| gi|188989602|ref|YP_001901612.1| gi|66766540|ref|YP_241302.1| gi|21229664|ref|NP_635581.1| gi|21240979|ref|NP_640561.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]