SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 509170.ABSDF0717 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  509170.ABSDF0717
Domain Number 1 Region: 85-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000379
Family NfeD domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 509170.ABSDF0717
Sequence length 153
Comment (Acinetobacter baumannii SDF)
Sequence
MEFVVEPWHWFVLGILLILSELILPAFAALWFGIAAIMVCFLYWLFPDISLTTQIVLWIV
LSVLCTLLWFKFIKPLSIDKTKAGLPREATIGQIGMVIQTELAHDQIIVRFPMPILGADE
WNCRSTIPVKVGDRVQVIDISGNDLIVQPHSTS
Download sequence
Identical sequences B0VSF1
gi|169632579|ref|YP_001706315.1| 509170.ABSDF0717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]