SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 511145.b0488 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  511145.b0488
Domain Number 1 Region: 95-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000942
Family NfeD domain-like 0.0079
Further Details:      
 
Weak hits

Sequence:  511145.b0488
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000497
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 511145.b0488
Sequence length 152
Comment (Escherichia coli K 12 substr MG1655)
Sequence
MMELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMF
AILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS
WPVSASEDLGAGTHVEVIAIEGITLHIRAVSS
Download sequence
Identical sequences A0A024L5W6 A0A026UGN7 A0A027TL20 A0A028AIE1 A0A028DKB1 A0A070F7R0 A0A070T5J0 A0A0A0FCA6 A0A0A8UNP3 A0A0E0TUF0 A0A0E0Y2Y9 A0A0E1LUE2 A0A0E2TIK7 A0A0I2W6X2 A0A0M9J3X1 A0A127GHF2 A0A1S6T7M7 A0A1S9K3E1 A0A1W2N0X7 A0A1X3IRH7 A0A1X3JMA4 A0A1X3L7N3 A0A222QG73 A0A226K5H3 A0A236MA64 A7ZIP8 D2A8P5 D7XK34 D7Y7K5 D8E0V9 E0J6R6 E1J024 E6BHX4 F4NMP7 F4SJI8 F4VAS6 I0VQL3 I2S4L4 I2UQI3 I2W654 I2WQZ0 I4SYF2 I6C262 K4V6R5 K4WQI9 L2V8L9 M9GE72 P0AAS3 P0AAS4 S1E2D5 S1EUX3 S1H3R1 S1I5R4 S1III9 U9XND8 U9ZQM8 V2RZ75 V8FMT2 W1F4L0
gi|170021124|ref|YP_001726078.1| gi|378714107|ref|YP_005279000.1| 331111.EcE24377A_0527 331112.EcHS_A0567 481805.EcolC_3128 511145.b0488 595496.BWG_0369 gi|386612685|ref|YP_006132351.1| gi|386708290|ref|YP_006172011.1| gi|157158261|ref|YP_001461677.1| gi|378714107|ref|YP_005279000.1| gi|384542043|ref|YP_005726104.1| gi|387620246|ref|YP_006127873.1| gi|383177084|ref|YP_005455089.1| gi|410483884|ref|YP_006771430.1| gi|386703705|ref|YP_006167552.1| gi|544389315|ref|YP_008563697.1| gi|407467937|ref|YP_006785621.1| GO.3524 gi|386708290|ref|YP_006172011.1| gi|145698226|ref|NP_415021.2| gi|387620246|ref|YP_006127873.1| gi|443616515|ref|YP_007380371.1| NP_415021.2.90541 WP_000970323.1.1000 WP_000970323.1.100044 WP_000970323.1.100063 WP_000970323.1.100066 WP_000970323.1.100085 WP_000970323.1.100111 WP_000970323.1.100116 WP_000970323.1.100135 WP_000970323.1.100159 WP_000970323.1.100185 WP_000970323.1.100252 WP_000970323.1.100283 WP_000970323.1.100315 WP_000970323.1.10034 WP_000970323.1.100346 WP_000970323.1.100389 WP_000970323.1.100425 WP_000970323.1.100441 WP_000970323.1.100444 WP_000970323.1.100447 WP_000970323.1.100448 WP_000970323.1.100451 WP_000970323.1.10048 WP_000970323.1.100487 WP_000970323.1.100496 WP_000970323.1.100499 WP_000970323.1.10051 WP_000970323.1.100543 WP_000970323.1.100571 WP_000970323.1.100573 WP_000970323.1.100614 WP_000970323.1.100689 WP_000970323.1.100718 WP_000970323.1.100725 WP_000970323.1.100758 WP_000970323.1.100778 WP_000970323.1.100796 WP_000970323.1.10080 WP_000970323.1.100824 WP_000970323.1.100851 WP_000970323.1.100852 WP_000970323.1.10086 WP_000970323.1.100928 WP_000970323.1.100933 WP_000970323.1.10094 WP_000970323.1.100990 WP_000970323.1.101033 WP_000970323.1.101096 WP_000970323.1.101121 WP_000970323.1.101157 WP_000970323.1.101158 WP_000970323.1.101175 WP_000970323.1.101186 WP_000970323.1.101214 WP_000970323.1.101257 WP_000970323.1.101282 WP_000970323.1.101289 WP_000970323.1.101313 WP_000970323.1.101359 WP_000970323.1.101387 WP_000970323.1.101418 WP_000970323.1.101423 WP_000970323.1.101436 WP_000970323.1.101468 WP_000970323.1.101486 WP_000970323.1.101518 WP_000970323.1.101522 WP_000970323.1.10154 WP_000970323.1.101545 WP_000970323.1.101594 WP_000970323.1.101630 WP_000970323.1.101651 WP_000970323.1.101653 WP_000970323.1.101654 WP_000970323.1.101667 WP_000970323.1.101668 WP_000970323.1.101686 WP_000970323.1.10173 WP_000970323.1.101747 WP_000970323.1.101777 WP_000970323.1.101786 WP_000970323.1.101840 WP_000970323.1.101845 WP_000970323.1.101865 WP_000970323.1.10187 WP_000970323.1.10188 WP_000970323.1.101887 WP_000970323.1.101889 WP_000970323.1.10190 WP_000970323.1.101900 WP_000970323.1.101908 WP_000970323.1.101913 WP_000970323.1.101937 WP_000970323.1.101940 WP_000970323.1.101942 WP_000970323.1.101947 WP_000970323.1.101964 WP_000970323.1.101969 WP_000970323.1.101987 WP_000970323.1.102021 WP_000970323.1.102069 WP_000970323.1.102093 WP_000970323.1.102122 WP_000970323.1.10222 WP_000970323.1.10226 WP_000970323.1.10233 WP_000970323.1.10235 WP_000970323.1.10252 WP_000970323.1.10329 WP_000970323.1.10348 WP_000970323.1.10352 WP_000970323.1.10361 WP_000970323.1.10379 WP_000970323.1.1040 WP_000970323.1.10400 WP_000970323.1.10417 WP_000970323.1.10461 WP_000970323.1.10491 WP_000970323.1.10496 WP_000970323.1.10508 WP_000970323.1.10525 WP_000970323.1.10538 WP_000970323.1.10576 WP_000970323.1.10579 WP_000970323.1.1058 WP_000970323.1.10628 WP_000970323.1.10673 WP_000970323.1.10715 WP_000970323.1.1073 WP_000970323.1.1074 WP_000970323.1.10763 WP_000970323.1.10771 WP_000970323.1.10798 WP_000970323.1.10833 WP_000970323.1.10862 WP_000970323.1.10922 WP_000970323.1.10988 WP_000970323.1.10989 WP_000970323.1.10995 WP_000970323.1.11032 WP_000970323.1.11047 WP_000970323.1.11071 WP_000970323.1.11118 WP_000970323.1.11121 WP_000970323.1.1113 WP_000970323.1.1122 WP_000970323.1.11241 WP_000970323.1.11251 WP_000970323.1.11272 WP_000970323.1.11296 WP_000970323.1.11323 WP_000970323.1.11408 WP_000970323.1.11418 WP_000970323.1.11436 WP_000970323.1.11437 WP_000970323.1.11440 WP_000970323.1.11452 WP_000970323.1.11499 WP_000970323.1.11595 WP_000970323.1.11616 WP_000970323.1.11673 WP_000970323.1.11699 WP_000970323.1.11748 WP_000970323.1.11759 WP_000970323.1.1176 WP_000970323.1.11762 WP_000970323.1.11801 WP_000970323.1.11803 WP_000970323.1.11844 WP_000970323.1.11912 WP_000970323.1.11949 WP_000970323.1.1196 WP_000970323.1.11985 WP_000970323.1.12000 WP_000970323.1.12030 WP_000970323.1.12036 WP_000970323.1.12051 WP_000970323.1.12095 WP_000970323.1.12112 WP_000970323.1.1212 WP_000970323.1.1218 WP_000970323.1.12204 WP_000970323.1.12279 WP_000970323.1.12292 WP_000970323.1.12320 WP_000970323.1.12342 WP_000970323.1.12344 WP_000970323.1.12415 WP_000970323.1.1242 WP_000970323.1.12426 WP_000970323.1.12458 WP_000970323.1.12468 WP_000970323.1.12542 WP_000970323.1.12558 WP_000970323.1.12582 WP_000970323.1.12645 WP_000970323.1.12693 WP_000970323.1.127 WP_000970323.1.12717 WP_000970323.1.12743 WP_000970323.1.12749 WP_000970323.1.1275 WP_000970323.1.12756 WP_000970323.1.12762 WP_000970323.1.12775 WP_000970323.1.12781 WP_000970323.1.1280 WP_000970323.1.12831 WP_000970323.1.12876 WP_000970323.1.12911 WP_000970323.1.1295 WP_000970323.1.12965 WP_000970323.1.12987 WP_000970323.1.13015 WP_000970323.1.13031 WP_000970323.1.13074 WP_000970323.1.1312 WP_000970323.1.13136 WP_000970323.1.13144 WP_000970323.1.13157 WP_000970323.1.13162 WP_000970323.1.13176 WP_000970323.1.13222 WP_000970323.1.13239 WP_000970323.1.13252 WP_000970323.1.13258 WP_000970323.1.13278 WP_000970323.1.13333 WP_000970323.1.13346 WP_000970323.1.13383 WP_000970323.1.13411 WP_000970323.1.13437 WP_000970323.1.1345 WP_000970323.1.13451 WP_000970323.1.13492 WP_000970323.1.13495 WP_000970323.1.13566 WP_000970323.1.13585 WP_000970323.1.13589 WP_000970323.1.13608 WP_000970323.1.13618 WP_000970323.1.13624 WP_000970323.1.13644 WP_000970323.1.13656 WP_000970323.1.13664 WP_000970323.1.13672 WP_000970323.1.13740 WP_000970323.1.13798 WP_000970323.1.13824 WP_000970323.1.13867 WP_000970323.1.13877 WP_000970323.1.13891 WP_000970323.1.13924 WP_000970323.1.13944 WP_000970323.1.13949 WP_000970323.1.13974 WP_000970323.1.13981 WP_000970323.1.14030 WP_000970323.1.14058 WP_000970323.1.14062 WP_000970323.1.14070 WP_000970323.1.14094 WP_000970323.1.14127 WP_000970323.1.14154 WP_000970323.1.1419 WP_000970323.1.142 WP_000970323.1.14253 WP_000970323.1.14277 WP_000970323.1.14292 WP_000970323.1.14299 WP_000970323.1.14346 WP_000970323.1.1438 WP_000970323.1.1439 WP_000970323.1.14398 WP_000970323.1.14417 WP_000970323.1.14451 WP_000970323.1.14468 WP_000970323.1.14499 WP_000970323.1.14501 WP_000970323.1.14508 WP_000970323.1.14529 WP_000970323.1.14536 WP_000970323.1.14600 WP_000970323.1.14601 WP_000970323.1.1461 WP_000970323.1.14648 WP_000970323.1.14661 WP_000970323.1.14672 WP_000970323.1.14678 WP_000970323.1.14693 WP_000970323.1.14711 WP_000970323.1.14811 WP_000970323.1.14833 WP_000970323.1.1486 WP_000970323.1.14861 WP_000970323.1.14871 WP_000970323.1.14879 WP_000970323.1.14956 WP_000970323.1.14958 WP_000970323.1.14965 WP_000970323.1.14977 WP_000970323.1.14992 WP_000970323.1.14993 WP_000970323.1.15007 WP_000970323.1.15041 WP_000970323.1.1508 WP_000970323.1.15087 WP_000970323.1.1510 WP_000970323.1.15117 WP_000970323.1.1512 WP_000970323.1.15121 WP_000970323.1.15138 WP_000970323.1.15148 WP_000970323.1.15191 WP_000970323.1.15193 WP_000970323.1.15207 WP_000970323.1.15221 WP_000970323.1.1524 WP_000970323.1.15245 WP_000970323.1.15252 WP_000970323.1.15259 WP_000970323.1.15282 WP_000970323.1.15287 WP_000970323.1.15300 WP_000970323.1.15332 WP_000970323.1.15335 WP_000970323.1.15377 WP_000970323.1.15416 WP_000970323.1.1543 WP_000970323.1.15464 WP_000970323.1.15469 WP_000970323.1.15496 WP_000970323.1.15528 WP_000970323.1.15565 WP_000970323.1.15576 WP_000970323.1.15583 WP_000970323.1.15593 WP_000970323.1.15600 WP_000970323.1.1561 WP_000970323.1.15620 WP_000970323.1.15645 WP_000970323.1.15740 WP_000970323.1.15747 WP_000970323.1.15752 WP_000970323.1.15762 WP_000970323.1.15767 WP_000970323.1.15768 WP_000970323.1.15771 WP_000970323.1.15791 WP_000970323.1.1580 WP_000970323.1.1582 WP_000970323.1.1588 WP_000970323.1.15894 WP_000970323.1.15916 WP_000970323.1.15983 WP_000970323.1.16014 WP_000970323.1.16015 WP_000970323.1.16042 WP_000970323.1.16086 WP_000970323.1.16087 WP_000970323.1.1609 WP_000970323.1.16102 WP_000970323.1.16111 WP_000970323.1.16154 WP_000970323.1.16171 WP_000970323.1.16179 WP_000970323.1.16183 WP_000970323.1.16188 WP_000970323.1.1621 WP_000970323.1.16294 WP_000970323.1.163 WP_000970323.1.16303 WP_000970323.1.1634 WP_000970323.1.16387 WP_000970323.1.1640 WP_000970323.1.16435 WP_000970323.1.16482 WP_000970323.1.16500 WP_000970323.1.16517 WP_000970323.1.16532 WP_000970323.1.16539 WP_000970323.1.16541 WP_000970323.1.1655 WP_000970323.1.16577 WP_000970323.1.16592 WP_000970323.1.16640 WP_000970323.1.16669 WP_000970323.1.16682 WP_000970323.1.16700 WP_000970323.1.16715 WP_000970323.1.16721 WP_000970323.1.16752 WP_000970323.1.16805 WP_000970323.1.16861 WP_000970323.1.16862 WP_000970323.1.16894 WP_000970323.1.16970 WP_000970323.1.16992 WP_000970323.1.17017 WP_000970323.1.17018 WP_000970323.1.17042 WP_000970323.1.17084 WP_000970323.1.17085 WP_000970323.1.17087 WP_000970323.1.17089 WP_000970323.1.1710 WP_000970323.1.17101 WP_000970323.1.17102 WP_000970323.1.17111 WP_000970323.1.17114 WP_000970323.1.17119 WP_000970323.1.17123 WP_000970323.1.17150 WP_000970323.1.17170 WP_000970323.1.17172 WP_000970323.1.17182 WP_000970323.1.17205 WP_000970323.1.17216 WP_000970323.1.17230 WP_000970323.1.17241 WP_000970323.1.17242 WP_000970323.1.1726 WP_000970323.1.17267 WP_000970323.1.17282 WP_000970323.1.17290 WP_000970323.1.17297 WP_000970323.1.17300 WP_000970323.1.17301 WP_000970323.1.17373 WP_000970323.1.17389 WP_000970323.1.17392 WP_000970323.1.17417 WP_000970323.1.17432 WP_000970323.1.17441 WP_000970323.1.17464 WP_000970323.1.17534 WP_000970323.1.1754 WP_000970323.1.1755 WP_000970323.1.17550 WP_000970323.1.17570 WP_000970323.1.17577 WP_000970323.1.17623 WP_000970323.1.1763 WP_000970323.1.17637 WP_000970323.1.17680 WP_000970323.1.17711 WP_000970323.1.17734 WP_000970323.1.17765 WP_000970323.1.17766 WP_000970323.1.1778 WP_000970323.1.17802 WP_000970323.1.17831 WP_000970323.1.17836 WP_000970323.1.17889 WP_000970323.1.17920 WP_000970323.1.17952 WP_000970323.1.17963 WP_000970323.1.17984 WP_000970323.1.18000 WP_000970323.1.18006 WP_000970323.1.18050 WP_000970323.1.18064 WP_000970323.1.18133 WP_000970323.1.18134 WP_000970323.1.18164 WP_000970323.1.18175 WP_000970323.1.18226 WP_000970323.1.18229 WP_000970323.1.18311 WP_000970323.1.18354 WP_000970323.1.18381 WP_000970323.1.18436 WP_000970323.1.18438 WP_000970323.1.1844 WP_000970323.1.18458 WP_000970323.1.18482 WP_000970323.1.18511 WP_000970323.1.18519 WP_000970323.1.18530 WP_000970323.1.18550 WP_000970323.1.18583 WP_000970323.1.18628 WP_000970323.1.18650 WP_000970323.1.18666 WP_000970323.1.1867 WP_000970323.1.18675 WP_000970323.1.18699 WP_000970323.1.18714 WP_000970323.1.18726 WP_000970323.1.188 WP_000970323.1.18806 WP_000970323.1.18858 WP_000970323.1.18861 WP_000970323.1.18874 WP_000970323.1.18876 WP_000970323.1.18899 WP_000970323.1.18923 WP_000970323.1.18983 WP_000970323.1.19024 WP_000970323.1.1903 WP_000970323.1.19075 WP_000970323.1.1909 WP_000970323.1.19090 WP_000970323.1.19100 WP_000970323.1.19113 WP_000970323.1.19114 WP_000970323.1.19122 WP_000970323.1.19147 WP_000970323.1.19148 WP_000970323.1.1915 WP_000970323.1.19150 WP_000970323.1.19194 WP_000970323.1.19206 WP_000970323.1.1925 WP_000970323.1.19277 WP_000970323.1.19297 WP_000970323.1.193 WP_000970323.1.19312 WP_000970323.1.19313 WP_000970323.1.19315 WP_000970323.1.19332 WP_000970323.1.19338 WP_000970323.1.19347 WP_000970323.1.19361 WP_000970323.1.19389 WP_000970323.1.19397 WP_000970323.1.19424 WP_000970323.1.19453 WP_000970323.1.19478 WP_000970323.1.19487 WP_000970323.1.19494 WP_000970323.1.19557 WP_000970323.1.19581 WP_000970323.1.19583 WP_000970323.1.19602 WP_000970323.1.1963 WP_000970323.1.19644 WP_000970323.1.19651 WP_000970323.1.19684 WP_000970323.1.19691 WP_000970323.1.19758 WP_000970323.1.19778 WP_000970323.1.19795 WP_000970323.1.1982 WP_000970323.1.19838 WP_000970323.1.19845 WP_000970323.1.19873 WP_000970323.1.19878 WP_000970323.1.19889 WP_000970323.1.19940 WP_000970323.1.19945 WP_000970323.1.19957 WP_000970323.1.19994 WP_000970323.1.20025 WP_000970323.1.20096 WP_000970323.1.20129 WP_000970323.1.20136 WP_000970323.1.2015 WP_000970323.1.20151 WP_000970323.1.20157 WP_000970323.1.20159 WP_000970323.1.20164 WP_000970323.1.20183 WP_000970323.1.20192 WP_000970323.1.2022 WP_000970323.1.20230 WP_000970323.1.20251 WP_000970323.1.20290 WP_000970323.1.20308 WP_000970323.1.20318 WP_000970323.1.20325 WP_000970323.1.20331 WP_000970323.1.20334 WP_000970323.1.20370 WP_000970323.1.20484 WP_000970323.1.20506 WP_000970323.1.20519 WP_000970323.1.20536 WP_000970323.1.20549 WP_000970323.1.20596 WP_000970323.1.20630 WP_000970323.1.20636 WP_000970323.1.20638 WP_000970323.1.20662 WP_000970323.1.20668 WP_000970323.1.20691 WP_000970323.1.20724 WP_000970323.1.20730 WP_000970323.1.20737 WP_000970323.1.20785 WP_000970323.1.20813 WP_000970323.1.20831 WP_000970323.1.20907 WP_000970323.1.2093 WP_000970323.1.20943 WP_000970323.1.20958 WP_000970323.1.20982 WP_000970323.1.2100 WP_000970323.1.21022 WP_000970323.1.21024 WP_000970323.1.21029 WP_000970323.1.21033 WP_000970323.1.21041 WP_000970323.1.21057 WP_000970323.1.21059 WP_000970323.1.21104 WP_000970323.1.21122 WP_000970323.1.21129 WP_000970323.1.2113 WP_000970323.1.21131 WP_000970323.1.21137 WP_000970323.1.21171 WP_000970323.1.21197 WP_000970323.1.21248 WP_000970323.1.21251 WP_000970323.1.21277 WP_000970323.1.21305 WP_000970323.1.21336 WP_000970323.1.2142 WP_000970323.1.21470 WP_000970323.1.21519 WP_000970323.1.2156 WP_000970323.1.21573 WP_000970323.1.21578 WP_000970323.1.21596 WP_000970323.1.21628 WP_000970323.1.21637 WP_000970323.1.2164 WP_000970323.1.21661 WP_000970323.1.21667 WP_000970323.1.21673 WP_000970323.1.21727 WP_000970323.1.21732 WP_000970323.1.21733 WP_000970323.1.21758 WP_000970323.1.21762 WP_000970323.1.21771 WP_000970323.1.21811 WP_000970323.1.21812 WP_000970323.1.21823 WP_000970323.1.21887 WP_000970323.1.21895 WP_000970323.1.21948 WP_000970323.1.22060 WP_000970323.1.22113 WP_000970323.1.22138 WP_000970323.1.22195 WP_000970323.1.22268 WP_000970323.1.22291 WP_000970323.1.22295 WP_000970323.1.22314 WP_000970323.1.22325 WP_000970323.1.22328 WP_000970323.1.22350 WP_000970323.1.22359 WP_000970323.1.22363 WP_000970323.1.22409 WP_000970323.1.22450 WP_000970323.1.22470 WP_000970323.1.22494 WP_000970323.1.22501 WP_000970323.1.22522 WP_000970323.1.22544 WP_000970323.1.22571 WP_000970323.1.22574 WP_000970323.1.22579 WP_000970323.1.22599 WP_000970323.1.22631 WP_000970323.1.22632 WP_000970323.1.22641 WP_000970323.1.22662 WP_000970323.1.22669 WP_000970323.1.22685 WP_000970323.1.22690 WP_000970323.1.22756 WP_000970323.1.22765 WP_000970323.1.22771 WP_000970323.1.22783 WP_000970323.1.22809 WP_000970323.1.22827 WP_000970323.1.22830 WP_000970323.1.22846 WP_000970323.1.22868 WP_000970323.1.22875 WP_000970323.1.22885 WP_000970323.1.22908 WP_000970323.1.22990 WP_000970323.1.2300 WP_000970323.1.23005 WP_000970323.1.23026 WP_000970323.1.23035 WP_000970323.1.23042 WP_000970323.1.23044 WP_000970323.1.23045 WP_000970323.1.23057 WP_000970323.1.23062 WP_000970323.1.23078 WP_000970323.1.23081 WP_000970323.1.23090 WP_000970323.1.23092 WP_000970323.1.23105 WP_000970323.1.23120 WP_000970323.1.23135 WP_000970323.1.2325 WP_000970323.1.23257 WP_000970323.1.23270 WP_000970323.1.23290 WP_000970323.1.23293 WP_000970323.1.23352 WP_000970323.1.23378 WP_000970323.1.23383 WP_000970323.1.23388 WP_000970323.1.23393 WP_000970323.1.23443 WP_000970323.1.23456 WP_000970323.1.23463 WP_000970323.1.23487 WP_000970323.1.23511 WP_000970323.1.23527 WP_000970323.1.2353 WP_000970323.1.23549 WP_000970323.1.23554 WP_000970323.1.23561 WP_000970323.1.23563 WP_000970323.1.23584 WP_000970323.1.23593 WP_000970323.1.2362 WP_000970323.1.23622 WP_000970323.1.23640 WP_000970323.1.23660 WP_000970323.1.23693 WP_000970323.1.23729 WP_000970323.1.23741 WP_000970323.1.23754 WP_000970323.1.23795 WP_000970323.1.23812 WP_000970323.1.23881 WP_000970323.1.23886 WP_000970323.1.23898 WP_000970323.1.23914 WP_000970323.1.23915 WP_000970323.1.23931 WP_000970323.1.23945 WP_000970323.1.2395 WP_000970323.1.23950 WP_000970323.1.23970 WP_000970323.1.23971 WP_000970323.1.24 WP_000970323.1.24024 WP_000970323.1.24045 WP_000970323.1.24051 WP_000970323.1.24058 WP_000970323.1.24068 WP_000970323.1.24089 WP_000970323.1.24120 WP_000970323.1.24122 WP_000970323.1.24124 WP_000970323.1.24194 WP_000970323.1.24233 WP_000970323.1.24278 WP_000970323.1.2428 WP_000970323.1.24290 WP_000970323.1.2430 WP_000970323.1.24304 WP_000970323.1.2433 WP_000970323.1.24362 WP_000970323.1.2437 WP_000970323.1.24374 WP_000970323.1.24381 WP_000970323.1.24485 WP_000970323.1.24499 WP_000970323.1.24533 WP_000970323.1.24536 WP_000970323.1.24547 WP_000970323.1.2456 WP_000970323.1.24560 WP_000970323.1.24570 WP_000970323.1.24575 WP_000970323.1.24616 WP_000970323.1.24641 WP_000970323.1.24642 WP_000970323.1.24646 WP_000970323.1.24650 WP_000970323.1.24693 WP_000970323.1.24783 WP_000970323.1.2479 WP_000970323.1.24791 WP_000970323.1.24799 WP_000970323.1.24876 WP_000970323.1.24899 WP_000970323.1.24929 WP_000970323.1.24939 WP_000970323.1.24946 WP_000970323.1.24960 WP_000970323.1.24981 WP_000970323.1.24982 WP_000970323.1.24984 WP_000970323.1.25019 WP_000970323.1.25038 WP_000970323.1.25042 WP_000970323.1.25050 WP_000970323.1.25060 WP_000970323.1.25085 WP_000970323.1.25086 WP_000970323.1.25087 WP_000970323.1.25126 WP_000970323.1.25183 WP_000970323.1.25203 WP_000970323.1.25289 WP_000970323.1.25324 WP_000970323.1.25346 WP_000970323.1.2537 WP_000970323.1.25378 WP_000970323.1.254 WP_000970323.1.25403 WP_000970323.1.25414 WP_000970323.1.2543 WP_000970323.1.255 WP_000970323.1.25517 WP_000970323.1.25525 WP_000970323.1.25548 WP_000970323.1.2558 WP_000970323.1.25592 WP_000970323.1.25598 WP_000970323.1.25602 WP_000970323.1.25631 WP_000970323.1.25643 WP_000970323.1.25652 WP_000970323.1.25713 WP_000970323.1.25717 WP_000970323.1.25718 WP_000970323.1.25726 WP_000970323.1.25753 WP_000970323.1.25755 WP_000970323.1.25799 WP_000970323.1.25843 WP_000970323.1.25855 WP_000970323.1.2588 WP_000970323.1.25886 WP_000970323.1.2589 WP_000970323.1.25915 WP_000970323.1.25945 WP_000970323.1.26005 WP_000970323.1.26048 WP_000970323.1.26055 WP_000970323.1.26061 WP_000970323.1.26100 WP_000970323.1.2612 WP_000970323.1.26125 WP_000970323.1.26135 WP_000970323.1.26150 WP_000970323.1.26161 WP_000970323.1.26186 WP_000970323.1.26270 WP_000970323.1.26331 WP_000970323.1.2637 WP_000970323.1.26379 WP_000970323.1.26401 WP_000970323.1.26403 WP_000970323.1.2642 WP_000970323.1.26467 WP_000970323.1.26479 WP_000970323.1.26480 WP_000970323.1.26570 WP_000970323.1.26575 WP_000970323.1.26588 WP_000970323.1.26598 WP_000970323.1.26609 WP_000970323.1.26613 WP_000970323.1.26658 WP_000970323.1.26683 WP_000970323.1.26720 WP_000970323.1.26736 WP_000970323.1.26941 WP_000970323.1.26943 WP_000970323.1.27019 WP_000970323.1.27060 WP_000970323.1.27098 WP_000970323.1.27101 WP_000970323.1.27105 WP_000970323.1.2712 WP_000970323.1.27134 WP_000970323.1.27141 WP_000970323.1.27148 WP_000970323.1.27175 WP_000970323.1.27214 WP_000970323.1.27234 WP_000970323.1.27260 WP_000970323.1.27280 WP_000970323.1.27283 WP_000970323.1.2731 WP_000970323.1.27310 WP_000970323.1.27367 WP_000970323.1.27373 WP_000970323.1.27424 WP_000970323.1.27426 WP_000970323.1.27472 WP_000970323.1.27504 WP_000970323.1.27524 WP_000970323.1.2755 WP_000970323.1.27560 WP_000970323.1.27580 WP_000970323.1.27683 WP_000970323.1.27691 WP_000970323.1.27698 WP_000970323.1.27742 WP_000970323.1.27749 WP_000970323.1.27758 WP_000970323.1.27774 WP_000970323.1.27786 WP_000970323.1.27856 WP_000970323.1.27876 WP_000970323.1.27879 WP_000970323.1.27897 WP_000970323.1.27923 WP_000970323.1.27957 WP_000970323.1.28046 WP_000970323.1.28109 WP_000970323.1.2811 WP_000970323.1.28110 WP_000970323.1.28128 WP_000970323.1.28168 WP_000970323.1.2823 WP_000970323.1.28250 WP_000970323.1.2826 WP_000970323.1.28271 WP_000970323.1.28305 WP_000970323.1.28371 WP_000970323.1.28401 WP_000970323.1.28414 WP_000970323.1.28440 WP_000970323.1.28480 WP_000970323.1.28491 WP_000970323.1.28496 WP_000970323.1.28509 WP_000970323.1.28523 WP_000970323.1.28540 WP_000970323.1.28544 WP_000970323.1.28662 WP_000970323.1.28683 WP_000970323.1.28697 WP_000970323.1.28711 WP_000970323.1.28760 WP_000970323.1.28762 WP_000970323.1.28769 WP_000970323.1.28791 WP_000970323.1.28809 WP_000970323.1.28835 WP_000970323.1.28919 WP_000970323.1.28950 WP_000970323.1.28953 WP_000970323.1.28982 WP_000970323.1.290 WP_000970323.1.29013 WP_000970323.1.29016 WP_000970323.1.29026 WP_000970323.1.29061 WP_000970323.1.29079 WP_000970323.1.29118 WP_000970323.1.29125 WP_000970323.1.29128 WP_000970323.1.29146 WP_000970323.1.29150 WP_000970323.1.29176 WP_000970323.1.29197 WP_000970323.1.29221 WP_000970323.1.29230 WP_000970323.1.29252 WP_000970323.1.2931 WP_000970323.1.2942 WP_000970323.1.2945 WP_000970323.1.29504 WP_000970323.1.2952 WP_000970323.1.2954 WP_000970323.1.29556 WP_000970323.1.29590 WP_000970323.1.29643 WP_000970323.1.29669 WP_000970323.1.29689 WP_000970323.1.29699 WP_000970323.1.29715 WP_000970323.1.29724 WP_000970323.1.29740 WP_000970323.1.29752 WP_000970323.1.29840 WP_000970323.1.2986 WP_000970323.1.29874 WP_000970323.1.29876 WP_000970323.1.2995 WP_000970323.1.29992 WP_000970323.1.30004 WP_000970323.1.30016 WP_000970323.1.30035 WP_000970323.1.30098 WP_000970323.1.30105 WP_000970323.1.30123 WP_000970323.1.30141 WP_000970323.1.30221 WP_000970323.1.30247 WP_000970323.1.30253 WP_000970323.1.30391 WP_000970323.1.30399 WP_000970323.1.30401 WP_000970323.1.3045 WP_000970323.1.30452 WP_000970323.1.30472 WP_000970323.1.30479 WP_000970323.1.30497 WP_000970323.1.30546 WP_000970323.1.30580 WP_000970323.1.3063 WP_000970323.1.30630 WP_000970323.1.30639 WP_000970323.1.30640 WP_000970323.1.30700 WP_000970323.1.30733 WP_000970323.1.30742 WP_000970323.1.30749 WP_000970323.1.30783 WP_000970323.1.30843 WP_000970323.1.30866 WP_000970323.1.30906 WP_000970323.1.30960 WP_000970323.1.31000 WP_000970323.1.31009 WP_000970323.1.31026 WP_000970323.1.31089 WP_000970323.1.31142 WP_000970323.1.31211 WP_000970323.1.31295 WP_000970323.1.31340 WP_000970323.1.31353 WP_000970323.1.31379 WP_000970323.1.31419 WP_000970323.1.31429 WP_000970323.1.31434 WP_000970323.1.31482 WP_000970323.1.31518 WP_000970323.1.31527 WP_000970323.1.31614 WP_000970323.1.31618 WP_000970323.1.31625 WP_000970323.1.31639 WP_000970323.1.31679 WP_000970323.1.3169 WP_000970323.1.31696 WP_000970323.1.31736 WP_000970323.1.31740 WP_000970323.1.3176 WP_000970323.1.31801 WP_000970323.1.31833 WP_000970323.1.31835 WP_000970323.1.31839 WP_000970323.1.31860 WP_000970323.1.31866 WP_000970323.1.31898 WP_000970323.1.31899 WP_000970323.1.31903 WP_000970323.1.31924 WP_000970323.1.3193 WP_000970323.1.31978 WP_000970323.1.32049 WP_000970323.1.32078 WP_000970323.1.32091 WP_000970323.1.32093 WP_000970323.1.32094 WP_000970323.1.3212 WP_000970323.1.32121 WP_000970323.1.32127 WP_000970323.1.32138 WP_000970323.1.32142 WP_000970323.1.32143 WP_000970323.1.3215 WP_000970323.1.32173 WP_000970323.1.32184 WP_000970323.1.32232 WP_000970323.1.32234 WP_000970323.1.32236 WP_000970323.1.32242 WP_000970323.1.32279 WP_000970323.1.32287 WP_000970323.1.32333 WP_000970323.1.32406 WP_000970323.1.32435 WP_000970323.1.32443 WP_000970323.1.32448 WP_000970323.1.3247 WP_000970323.1.32475 WP_000970323.1.32479 WP_000970323.1.3248 WP_000970323.1.32494 WP_000970323.1.32509 WP_000970323.1.32561 WP_000970323.1.32580 WP_000970323.1.32591 WP_000970323.1.32635 WP_000970323.1.32655 WP_000970323.1.327 WP_000970323.1.32709 WP_000970323.1.32715 WP_000970323.1.32720 WP_000970323.1.32722 WP_000970323.1.32724 WP_000970323.1.32741 WP_000970323.1.32815 WP_000970323.1.32831 WP_000970323.1.32835 WP_000970323.1.32875 WP_000970323.1.32903 WP_000970323.1.32910 WP_000970323.1.32946 WP_000970323.1.32972 WP_000970323.1.32984 WP_000970323.1.32995 WP_000970323.1.33053 WP_000970323.1.33119 WP_000970323.1.33171 WP_000970323.1.3323 WP_000970323.1.33237 WP_000970323.1.33244 WP_000970323.1.33325 WP_000970323.1.33341 WP_000970323.1.33362 WP_000970323.1.334 WP_000970323.1.33408 WP_000970323.1.33413 WP_000970323.1.33424 WP_000970323.1.33475 WP_000970323.1.33502 WP_000970323.1.33526 WP_000970323.1.3354 WP_000970323.1.33565 WP_000970323.1.33631 WP_000970323.1.33648 WP_000970323.1.33667 WP_000970323.1.33680 WP_000970323.1.33729 WP_000970323.1.33736 WP_000970323.1.33745 WP_000970323.1.33746 WP_000970323.1.33751 WP_000970323.1.33780 WP_000970323.1.33799 WP_000970323.1.33823 WP_000970323.1.33853 WP_000970323.1.33854 WP_000970323.1.33879 WP_000970323.1.33888 WP_000970323.1.33914 WP_000970323.1.33952 WP_000970323.1.33974 WP_000970323.1.33979 WP_000970323.1.3398 WP_000970323.1.34003 WP_000970323.1.3401 WP_000970323.1.34032 WP_000970323.1.34094 WP_000970323.1.34124 WP_000970323.1.3415 WP_000970323.1.34206 WP_000970323.1.34277 WP_000970323.1.34332 WP_000970323.1.34363 WP_000970323.1.34380 WP_000970323.1.34440 WP_000970323.1.34444 WP_000970323.1.34464 WP_000970323.1.34525 WP_000970323.1.34532 WP_000970323.1.34538 WP_000970323.1.34541 WP_000970323.1.34557 WP_000970323.1.34605 WP_000970323.1.34655 WP_000970323.1.34668 WP_000970323.1.347 WP_000970323.1.34727 WP_000970323.1.34781 WP_000970323.1.34782 WP_000970323.1.34794 WP_000970323.1.34827 WP_000970323.1.34948 WP_000970323.1.34982 WP_000970323.1.34983 WP_000970323.1.34990 WP_000970323.1.34993 WP_000970323.1.35039 WP_000970323.1.35114 WP_000970323.1.35180 WP_000970323.1.35186 WP_000970323.1.35195 WP_000970323.1.35202 WP_000970323.1.35204 WP_000970323.1.3521 WP_000970323.1.35211 WP_000970323.1.35316 WP_000970323.1.35360 WP_000970323.1.35365 WP_000970323.1.35368 WP_000970323.1.3539 WP_000970323.1.35398 WP_000970323.1.35464 WP_000970323.1.35465 WP_000970323.1.35468 WP_000970323.1.35581 WP_000970323.1.3560 WP_000970323.1.35649 WP_000970323.1.35651 WP_000970323.1.35653 WP_000970323.1.35654 WP_000970323.1.35698 WP_000970323.1.35724 WP_000970323.1.35740 WP_000970323.1.35922 WP_000970323.1.35927 WP_000970323.1.35934 WP_000970323.1.35942 WP_000970323.1.35959 WP_000970323.1.35983 WP_000970323.1.36040 WP_000970323.1.36042 WP_000970323.1.36071 WP_000970323.1.36085 WP_000970323.1.36094 WP_000970323.1.36129 WP_000970323.1.36159 WP_000970323.1.36164 WP_000970323.1.36166 WP_000970323.1.36177 WP_000970323.1.36182 WP_000970323.1.3620 WP_000970323.1.36281 WP_000970323.1.36299 WP_000970323.1.36332 WP_000970323.1.36334 WP_000970323.1.36386 WP_000970323.1.36393 WP_000970323.1.36453 WP_000970323.1.36496 WP_000970323.1.36507 WP_000970323.1.36523 WP_000970323.1.36531 WP_000970323.1.36610 WP_000970323.1.36707 WP_000970323.1.3671 WP_000970323.1.36746 WP_000970323.1.36747 WP_000970323.1.36806 WP_000970323.1.36812 WP_000970323.1.36817 WP_000970323.1.36826 WP_000970323.1.36833 WP_000970323.1.36925 WP_000970323.1.36971 WP_000970323.1.36975 WP_000970323.1.37006 WP_000970323.1.37020 WP_000970323.1.37046 WP_000970323.1.37057 WP_000970323.1.37076 WP_000970323.1.37099 WP_000970323.1.37101 WP_000970323.1.37122 WP_000970323.1.37146 WP_000970323.1.37155 WP_000970323.1.37206 WP_000970323.1.3723 WP_000970323.1.37233 WP_000970323.1.37252 WP_000970323.1.37261 WP_000970323.1.3730 WP_000970323.1.37329 WP_000970323.1.37352 WP_000970323.1.37371 WP_000970323.1.37419 WP_000970323.1.37433 WP_000970323.1.37445 WP_000970323.1.37476 WP_000970323.1.37485 WP_000970323.1.3749 WP_000970323.1.37510 WP_000970323.1.37538 WP_000970323.1.37543 WP_000970323.1.37549 WP_000970323.1.37576 WP_000970323.1.37588 WP_000970323.1.37634 WP_000970323.1.3772 WP_000970323.1.37730 WP_000970323.1.37745 WP_000970323.1.37758 WP_000970323.1.37762 WP_000970323.1.37773 WP_000970323.1.37847 WP_000970323.1.37852 WP_000970323.1.3788 WP_000970323.1.37880 WP_000970323.1.37887 WP_000970323.1.37897 WP_000970323.1.37917 WP_000970323.1.37940 WP_000970323.1.37964 WP_000970323.1.37995 WP_000970323.1.38033 WP_000970323.1.38080 WP_000970323.1.38081 WP_000970323.1.38085 WP_000970323.1.38105 WP_000970323.1.3811 WP_000970323.1.38119 WP_000970323.1.3815 WP_000970323.1.38162 WP_000970323.1.38182 WP_000970323.1.38202 WP_000970323.1.38211 WP_000970323.1.38264 WP_000970323.1.38323 WP_000970323.1.38357 WP_000970323.1.38363 WP_000970323.1.38371 WP_000970323.1.38412 WP_000970323.1.38419 WP_000970323.1.38485 WP_000970323.1.38533 WP_000970323.1.38544 WP_000970323.1.38584 WP_000970323.1.38610 WP_000970323.1.38626 WP_000970323.1.38629 WP_000970323.1.38636 WP_000970323.1.38694 WP_000970323.1.38722 WP_000970323.1.38777 WP_000970323.1.38811 WP_000970323.1.38827 WP_000970323.1.38843 WP_000970323.1.38896 WP_000970323.1.38911 WP_000970323.1.38920 WP_000970323.1.38935 WP_000970323.1.38950 WP_000970323.1.38956 WP_000970323.1.39005 WP_000970323.1.39015 WP_000970323.1.3903 WP_000970323.1.39037 WP_000970323.1.39042 WP_000970323.1.39063 WP_000970323.1.39103 WP_000970323.1.39111 WP_000970323.1.39123 WP_000970323.1.39150 WP_000970323.1.39155 WP_000970323.1.39157 WP_000970323.1.39164 WP_000970323.1.3921 WP_000970323.1.39249 WP_000970323.1.39302 WP_000970323.1.39305 WP_000970323.1.39342 WP_000970323.1.39356 WP_000970323.1.39358 WP_000970323.1.39365 WP_000970323.1.39367 WP_000970323.1.39373 WP_000970323.1.39430 WP_000970323.1.39468 WP_000970323.1.39509 WP_000970323.1.39531 WP_000970323.1.3954 WP_000970323.1.39541 WP_000970323.1.39580 WP_000970323.1.39594 WP_000970323.1.39606 WP_000970323.1.39610 WP_000970323.1.39636 WP_000970323.1.39690 WP_000970323.1.3970 WP_000970323.1.39715 WP_000970323.1.39730 WP_000970323.1.39780 WP_000970323.1.39818 WP_000970323.1.39822 WP_000970323.1.39829 WP_000970323.1.39870 WP_000970323.1.39961 WP_000970323.1.39966 WP_000970323.1.39970 WP_000970323.1.39992 WP_000970323.1.40013 WP_000970323.1.40016 WP_000970323.1.40088 WP_000970323.1.40121 WP_000970323.1.40147 WP_000970323.1.40159 WP_000970323.1.40183 WP_000970323.1.40192 WP_000970323.1.4020 WP_000970323.1.40206 WP_000970323.1.40212 WP_000970323.1.40218 WP_000970323.1.40238 WP_000970323.1.40249 WP_000970323.1.40317 WP_000970323.1.40382 WP_000970323.1.40389 WP_000970323.1.40499 WP_000970323.1.40502 WP_000970323.1.40524 WP_000970323.1.40548 WP_000970323.1.40596 WP_000970323.1.40599 WP_000970323.1.406 WP_000970323.1.40617 WP_000970323.1.40623 WP_000970323.1.40666 WP_000970323.1.40668 WP_000970323.1.40686 WP_000970323.1.40712 WP_000970323.1.40781 WP_000970323.1.4081 WP_000970323.1.40813 WP_000970323.1.40815 WP_000970323.1.4082 WP_000970323.1.40833 WP_000970323.1.40865 WP_000970323.1.40912 WP_000970323.1.40937 WP_000970323.1.40965 WP_000970323.1.41037 WP_000970323.1.41125 WP_000970323.1.41147 WP_000970323.1.41206 WP_000970323.1.41230 WP_000970323.1.41259 WP_000970323.1.4126 WP_000970323.1.41263 WP_000970323.1.41287 WP_000970323.1.41339 WP_000970323.1.41346 WP_000970323.1.41363 WP_000970323.1.41368 WP_000970323.1.41371 WP_000970323.1.41372 WP_000970323.1.41391 WP_000970323.1.41392 WP_000970323.1.41417 WP_000970323.1.41436 WP_000970323.1.41455 WP_000970323.1.41457 WP_000970323.1.41466 WP_000970323.1.41479 WP_000970323.1.41484 WP_000970323.1.41513 WP_000970323.1.41530 WP_000970323.1.41539 WP_000970323.1.41545 WP_000970323.1.41556 WP_000970323.1.41566 WP_000970323.1.41606 WP_000970323.1.41613 WP_000970323.1.41621 WP_000970323.1.41651 WP_000970323.1.41712 WP_000970323.1.41718 WP_000970323.1.4172 WP_000970323.1.41752 WP_000970323.1.41778 WP_000970323.1.41780 WP_000970323.1.41782 WP_000970323.1.41784 WP_000970323.1.41812 WP_000970323.1.41813 WP_000970323.1.41826 WP_000970323.1.41900 WP_000970323.1.41964 WP_000970323.1.41988 WP_000970323.1.42022 WP_000970323.1.42027 WP_000970323.1.42033 WP_000970323.1.42038 WP_000970323.1.42060 WP_000970323.1.42095 WP_000970323.1.42096 WP_000970323.1.42113 WP_000970323.1.42138 WP_000970323.1.4214 WP_000970323.1.42159 WP_000970323.1.42179 WP_000970323.1.42203 WP_000970323.1.42209 WP_000970323.1.42214 WP_000970323.1.42252 WP_000970323.1.42277 WP_000970323.1.42284 WP_000970323.1.42300 WP_000970323.1.42359 WP_000970323.1.42367 WP_000970323.1.42369 WP_000970323.1.42376 WP_000970323.1.42387 WP_000970323.1.42415 WP_000970323.1.42432 WP_000970323.1.42442 WP_000970323.1.42456 WP_000970323.1.42480 WP_000970323.1.42522 WP_000970323.1.42547 WP_000970323.1.42632 WP_000970323.1.42661 WP_000970323.1.42728 WP_000970323.1.42748 WP_000970323.1.42749 WP_000970323.1.42750 WP_000970323.1.42756 WP_000970323.1.42770 WP_000970323.1.42791 WP_000970323.1.4282 WP_000970323.1.42828 WP_000970323.1.42830 WP_000970323.1.42832 WP_000970323.1.42879 WP_000970323.1.42891 WP_000970323.1.42918 WP_000970323.1.42936 WP_000970323.1.42937 WP_000970323.1.42950 WP_000970323.1.42962 WP_000970323.1.42966 WP_000970323.1.42987 WP_000970323.1.42989 WP_000970323.1.4306 WP_000970323.1.43132 WP_000970323.1.43137 WP_000970323.1.43166 WP_000970323.1.43174 WP_000970323.1.43177 WP_000970323.1.43239 WP_000970323.1.43270 WP_000970323.1.43316 WP_000970323.1.43324 WP_000970323.1.43374 WP_000970323.1.43389 WP_000970323.1.4342 WP_000970323.1.43444 WP_000970323.1.43455 WP_000970323.1.43473 WP_000970323.1.43474 WP_000970323.1.43489 WP_000970323.1.43561 WP_000970323.1.43566 WP_000970323.1.43622 WP_000970323.1.43642 WP_000970323.1.43720 WP_000970323.1.43750 WP_000970323.1.43804 WP_000970323.1.43925 WP_000970323.1.43989 WP_000970323.1.4400 WP_000970323.1.44018 WP_000970323.1.44020 WP_000970323.1.44029 WP_000970323.1.44075 WP_000970323.1.44088 WP_000970323.1.44096 WP_000970323.1.44100 WP_000970323.1.4411 WP_000970323.1.44115 WP_000970323.1.4415 WP_000970323.1.44162 WP_000970323.1.44166 WP_000970323.1.44201 WP_000970323.1.44211 WP_000970323.1.44222 WP_000970323.1.44238 WP_000970323.1.44264 WP_000970323.1.44273 WP_000970323.1.44285 WP_000970323.1.44287 WP_000970323.1.44292 WP_000970323.1.44314 WP_000970323.1.44365 WP_000970323.1.44426 WP_000970323.1.4445 WP_000970323.1.44452 WP_000970323.1.4449 WP_000970323.1.44524 WP_000970323.1.44539 WP_000970323.1.44558 WP_000970323.1.44570 WP_000970323.1.44608 WP_000970323.1.44627 WP_000970323.1.44661 WP_000970323.1.44671 WP_000970323.1.44686 WP_000970323.1.44724 WP_000970323.1.4473 WP_000970323.1.448 WP_000970323.1.44814 WP_000970323.1.44818 WP_000970323.1.44821 WP_000970323.1.44840 WP_000970323.1.44848 WP_000970323.1.44849 WP_000970323.1.44854 WP_000970323.1.44857 WP_000970323.1.44923 WP_000970323.1.44961 WP_000970323.1.44970 WP_000970323.1.45000 WP_000970323.1.45025 WP_000970323.1.45028 WP_000970323.1.45043 WP_000970323.1.45104 WP_000970323.1.45116 WP_000970323.1.45156 WP_000970323.1.4516 WP_000970323.1.45208 WP_000970323.1.4524 WP_000970323.1.45246 WP_000970323.1.45301 WP_000970323.1.45313 WP_000970323.1.45329 WP_000970323.1.4535 WP_000970323.1.45392 WP_000970323.1.45444 WP_000970323.1.45494 WP_000970323.1.45500 WP_000970323.1.45538 WP_000970323.1.45581 WP_000970323.1.45595 WP_000970323.1.45600 WP_000970323.1.4563 WP_000970323.1.4574 WP_000970323.1.45741 WP_000970323.1.45752 WP_000970323.1.45799 WP_000970323.1.45840 WP_000970323.1.45846 WP_000970323.1.45865 WP_000970323.1.45868 WP_000970323.1.4593 WP_000970323.1.45930 WP_000970323.1.45933 WP_000970323.1.45949 WP_000970323.1.45960 WP_000970323.1.45962 WP_000970323.1.45991 WP_000970323.1.4600 WP_000970323.1.46026 WP_000970323.1.46027 WP_000970323.1.46048 WP_000970323.1.46049 WP_000970323.1.46081 WP_000970323.1.46097 WP_000970323.1.46105 WP_000970323.1.4613 WP_000970323.1.4617 WP_000970323.1.46186 WP_000970323.1.46197 WP_000970323.1.46213 WP_000970323.1.46239 WP_000970323.1.46245 WP_000970323.1.46257 WP_000970323.1.46301 WP_000970323.1.46325 WP_000970323.1.46329 WP_000970323.1.46429 WP_000970323.1.4643 WP_000970323.1.46433 WP_000970323.1.46441 WP_000970323.1.46468 WP_000970323.1.46526 WP_000970323.1.46552 WP_000970323.1.46555 WP_000970323.1.4657 WP_000970323.1.46582 WP_000970323.1.46602 WP_000970323.1.46616 WP_000970323.1.46643 WP_000970323.1.46655 WP_000970323.1.46668 WP_000970323.1.4670 WP_000970323.1.46734 WP_000970323.1.46743 WP_000970323.1.46802 WP_000970323.1.46820 WP_000970323.1.46857 WP_000970323.1.46860 WP_000970323.1.46882 WP_000970323.1.46909 WP_000970323.1.46932 WP_000970323.1.46999 WP_000970323.1.47028 WP_000970323.1.47029 WP_000970323.1.47030 WP_000970323.1.47034 WP_000970323.1.47038 WP_000970323.1.47048 WP_000970323.1.47050 WP_000970323.1.47156 WP_000970323.1.47186 WP_000970323.1.47198 WP_000970323.1.4722 WP_000970323.1.47224 WP_000970323.1.47246 WP_000970323.1.47280 WP_000970323.1.47316 WP_000970323.1.47322 WP_000970323.1.47350 WP_000970323.1.47356 WP_000970323.1.47363 WP_000970323.1.47398 WP_000970323.1.47401 WP_000970323.1.47414 WP_000970323.1.47416 WP_000970323.1.47425 WP_000970323.1.47451 WP_000970323.1.47473 WP_000970323.1.47477 WP_000970323.1.47496 WP_000970323.1.47582 WP_000970323.1.47634 WP_000970323.1.47646 WP_000970323.1.47662 WP_000970323.1.47673 WP_000970323.1.4772 WP_000970323.1.4773 WP_000970323.1.47734 WP_000970323.1.47744 WP_000970323.1.47761 WP_000970323.1.47765 WP_000970323.1.47770 WP_000970323.1.47775 WP_000970323.1.47790 WP_000970323.1.47820 WP_000970323.1.47848 WP_000970323.1.47914 WP_000970323.1.4796 WP_000970323.1.47976 WP_000970323.1.47981 WP_000970323.1.47983 WP_000970323.1.48000 WP_000970323.1.48018 WP_000970323.1.48040 WP_000970323.1.48073 WP_000970323.1.48077 WP_000970323.1.48080 WP_000970323.1.48087 WP_000970323.1.48096 WP_000970323.1.48111 WP_000970323.1.48144 WP_000970323.1.48188 WP_000970323.1.48194 WP_000970323.1.48203 WP_000970323.1.48222 WP_000970323.1.48285 WP_000970323.1.48290 WP_000970323.1.48291 WP_000970323.1.48353 WP_000970323.1.48385 WP_000970323.1.48404 WP_000970323.1.48417 WP_000970323.1.48421 WP_000970323.1.48433 WP_000970323.1.48477 WP_000970323.1.48480 WP_000970323.1.48483 WP_000970323.1.48505 WP_000970323.1.48522 WP_000970323.1.4857 WP_000970323.1.48571 WP_000970323.1.48590 WP_000970323.1.486 WP_000970323.1.48602 WP_000970323.1.48615 WP_000970323.1.48678 WP_000970323.1.4871 WP_000970323.1.48801 WP_000970323.1.48825 WP_000970323.1.48860 WP_000970323.1.48907 WP_000970323.1.48921 WP_000970323.1.48953 WP_000970323.1.48954 WP_000970323.1.48970 WP_000970323.1.48974 WP_000970323.1.49009 WP_000970323.1.49107 WP_000970323.1.49124 WP_000970323.1.49136 WP_000970323.1.49190 WP_000970323.1.49229 WP_000970323.1.49236 WP_000970323.1.49243 WP_000970323.1.49259 WP_000970323.1.49336 WP_000970323.1.49431 WP_000970323.1.49459 WP_000970323.1.49481 WP_000970323.1.49482 WP_000970323.1.4949 WP_000970323.1.49528 WP_000970323.1.49531 WP_000970323.1.49537 WP_000970323.1.49546 WP_000970323.1.49558 WP_000970323.1.49621 WP_000970323.1.49645 WP_000970323.1.49661 WP_000970323.1.49684 WP_000970323.1.49712 WP_000970323.1.49722 WP_000970323.1.49733 WP_000970323.1.49768 WP_000970323.1.49774 WP_000970323.1.49777 WP_000970323.1.49823 WP_000970323.1.49856 WP_000970323.1.49861 WP_000970323.1.49879 WP_000970323.1.49883 WP_000970323.1.49900 WP_000970323.1.49902 WP_000970323.1.49950 WP_000970323.1.49954 WP_000970323.1.50006 WP_000970323.1.50008 WP_000970323.1.50036 WP_000970323.1.50098 WP_000970323.1.50113 WP_000970323.1.50119 WP_000970323.1.50136 WP_000970323.1.5017 WP_000970323.1.50182 WP_000970323.1.50196 WP_000970323.1.50207 WP_000970323.1.50230 WP_000970323.1.50258 WP_000970323.1.50262 WP_000970323.1.50269 WP_000970323.1.50273 WP_000970323.1.50353 WP_000970323.1.50361 WP_000970323.1.50381 WP_000970323.1.5040 WP_000970323.1.5041 WP_000970323.1.50418 WP_000970323.1.50452 WP_000970323.1.5046 WP_000970323.1.50539 WP_000970323.1.50548 WP_000970323.1.5056 WP_000970323.1.50579 WP_000970323.1.50586 WP_000970323.1.506 WP_000970323.1.5061 WP_000970323.1.50616 WP_000970323.1.5067 WP_000970323.1.50715 WP_000970323.1.50717 WP_000970323.1.50725 WP_000970323.1.50936 WP_000970323.1.5095 WP_000970323.1.50969 WP_000970323.1.50993 WP_000970323.1.50996 WP_000970323.1.51013 WP_000970323.1.51042 WP_000970323.1.51058 WP_000970323.1.5106 WP_000970323.1.51109 WP_000970323.1.51127 WP_000970323.1.51172 WP_000970323.1.51175 WP_000970323.1.51206 WP_000970323.1.51248 WP_000970323.1.51255 WP_000970323.1.51260 WP_000970323.1.51278 WP_000970323.1.51299 WP_000970323.1.51320 WP_000970323.1.51354 WP_000970323.1.51364 WP_000970323.1.51405 WP_000970323.1.51425 WP_000970323.1.51427 WP_000970323.1.51430 WP_000970323.1.5146 WP_000970323.1.51462 WP_000970323.1.51482 WP_000970323.1.51490 WP_000970323.1.51495 WP_000970323.1.51503 WP_000970323.1.51513 WP_000970323.1.51537 WP_000970323.1.51539 WP_000970323.1.51542 WP_000970323.1.51552 WP_000970323.1.5157 WP_000970323.1.51580 WP_000970323.1.51600 WP_000970323.1.51607 WP_000970323.1.51624 WP_000970323.1.51629 WP_000970323.1.51662 WP_000970323.1.51707 WP_000970323.1.51718 WP_000970323.1.51736 WP_000970323.1.51784 WP_000970323.1.51839 WP_000970323.1.51869 WP_000970323.1.51968 WP_000970323.1.51985 WP_000970323.1.51988 WP_000970323.1.51999 WP_000970323.1.52002 WP_000970323.1.52011 WP_000970323.1.52020 WP_000970323.1.52044 WP_000970323.1.52062 WP_000970323.1.52076 WP_000970323.1.52111 WP_000970323.1.52126 WP_000970323.1.52135 WP_000970323.1.52186 WP_000970323.1.52200 WP_000970323.1.52211 WP_000970323.1.52214 WP_000970323.1.52225 WP_000970323.1.52230 WP_000970323.1.52236 WP_000970323.1.52240 WP_000970323.1.52243 WP_000970323.1.52249 WP_000970323.1.5227 WP_000970323.1.52272 WP_000970323.1.52304 WP_000970323.1.52305 WP_000970323.1.52324 WP_000970323.1.52328 WP_000970323.1.52378 WP_000970323.1.5239 WP_000970323.1.52399 WP_000970323.1.52406 WP_000970323.1.52413 WP_000970323.1.52492 WP_000970323.1.52524 WP_000970323.1.52544 WP_000970323.1.52554 WP_000970323.1.52558 WP_000970323.1.52567 WP_000970323.1.52601 WP_000970323.1.52612 WP_000970323.1.5265 WP_000970323.1.52662 WP_000970323.1.52691 WP_000970323.1.52704 WP_000970323.1.52710 WP_000970323.1.5272 WP_000970323.1.52735 WP_000970323.1.52755 WP_000970323.1.52762 WP_000970323.1.52774 WP_000970323.1.52777 WP_000970323.1.52780 WP_000970323.1.52801 WP_000970323.1.52844 WP_000970323.1.52846 WP_000970323.1.52853 WP_000970323.1.52881 WP_000970323.1.52895 WP_000970323.1.52908 WP_000970323.1.5291 WP_000970323.1.52913 WP_000970323.1.52942 WP_000970323.1.52962 WP_000970323.1.52995 WP_000970323.1.53012 WP_000970323.1.53020 WP_000970323.1.53099 WP_000970323.1.5310 WP_000970323.1.53110 WP_000970323.1.53155 WP_000970323.1.53186 WP_000970323.1.532 WP_000970323.1.5322 WP_000970323.1.53223 WP_000970323.1.53228 WP_000970323.1.53238 WP_000970323.1.53242 WP_000970323.1.53244 WP_000970323.1.53251 WP_000970323.1.53277 WP_000970323.1.53308 WP_000970323.1.53327 WP_000970323.1.53364 WP_000970323.1.53377 WP_000970323.1.53401 WP_000970323.1.53419 WP_000970323.1.5342 WP_000970323.1.53428 WP_000970323.1.53431 WP_000970323.1.53482 WP_000970323.1.53505 WP_000970323.1.5351 WP_000970323.1.53537 WP_000970323.1.53545 WP_000970323.1.53574 WP_000970323.1.53590 WP_000970323.1.53592 WP_000970323.1.53594 WP_000970323.1.5362 WP_000970323.1.53642 WP_000970323.1.53645 WP_000970323.1.53769 WP_000970323.1.53809 WP_000970323.1.53811 WP_000970323.1.53863 WP_000970323.1.53866 WP_000970323.1.53878 WP_000970323.1.53931 WP_000970323.1.5395 WP_000970323.1.53966 WP_000970323.1.53968 WP_000970323.1.53972 WP_000970323.1.53978 WP_000970323.1.53994 WP_000970323.1.54002 WP_000970323.1.54013 WP_000970323.1.54023 WP_000970323.1.54072 WP_000970323.1.54091 WP_000970323.1.54144 WP_000970323.1.54169 WP_000970323.1.54185 WP_000970323.1.54307 WP_000970323.1.54317 WP_000970323.1.54328 WP_000970323.1.54329 WP_000970323.1.5433 WP_000970323.1.54344 WP_000970323.1.5440 WP_000970323.1.54463 WP_000970323.1.54507 WP_000970323.1.54591 WP_000970323.1.5460 WP_000970323.1.54602 WP_000970323.1.54605 WP_000970323.1.5461 WP_000970323.1.54614 WP_000970323.1.54617 WP_000970323.1.54625 WP_000970323.1.54638 WP_000970323.1.54641 WP_000970323.1.54688 WP_000970323.1.54725 WP_000970323.1.54729 WP_000970323.1.54755 WP_000970323.1.54817 WP_000970323.1.54921 WP_000970323.1.54927 WP_000970323.1.54941 WP_000970323.1.54946 WP_000970323.1.54981 WP_000970323.1.54989 WP_000970323.1.55003 WP_000970323.1.55005 WP_000970323.1.55009 WP_000970323.1.55070 WP_000970323.1.55112 WP_000970323.1.55134 WP_000970323.1.55144 WP_000970323.1.55177 WP_000970323.1.55185 WP_000970323.1.55197 WP_000970323.1.5520 WP_000970323.1.55203 WP_000970323.1.55222 WP_000970323.1.55226 WP_000970323.1.55342 WP_000970323.1.55357 WP_000970323.1.55374 WP_000970323.1.55381 WP_000970323.1.55417 WP_000970323.1.55424 WP_000970323.1.55425 WP_000970323.1.55466 WP_000970323.1.55482 WP_000970323.1.55483 WP_000970323.1.55489 WP_000970323.1.55529 WP_000970323.1.55551 WP_000970323.1.55552 WP_000970323.1.55556 WP_000970323.1.55560 WP_000970323.1.55571 WP_000970323.1.55574 WP_000970323.1.55581 WP_000970323.1.55597 WP_000970323.1.55608 WP_000970323.1.5561 WP_000970323.1.55629 WP_000970323.1.5566 WP_000970323.1.5570 WP_000970323.1.55720 WP_000970323.1.55727 WP_000970323.1.55757 WP_000970323.1.55787 WP_000970323.1.55825 WP_000970323.1.55844 WP_000970323.1.55868 WP_000970323.1.55870 WP_000970323.1.55979 WP_000970323.1.55988 WP_000970323.1.561 WP_000970323.1.56101 WP_000970323.1.5614 WP_000970323.1.56149 WP_000970323.1.5616 WP_000970323.1.56164 WP_000970323.1.56216 WP_000970323.1.56231 WP_000970323.1.56345 WP_000970323.1.56358 WP_000970323.1.56371 WP_000970323.1.56388 WP_000970323.1.56390 WP_000970323.1.56399 WP_000970323.1.56436 WP_000970323.1.56439 WP_000970323.1.56446 WP_000970323.1.5646 WP_000970323.1.5649 WP_000970323.1.56513 WP_000970323.1.56528 WP_000970323.1.56543 WP_000970323.1.56573 WP_000970323.1.56586 WP_000970323.1.56665 WP_000970323.1.56680 WP_000970323.1.56689 WP_000970323.1.5670 WP_000970323.1.56704 WP_000970323.1.56713 WP_000970323.1.56721 WP_000970323.1.56742 WP_000970323.1.56776 WP_000970323.1.56777 WP_000970323.1.56786 WP_000970323.1.56787 WP_000970323.1.56799 WP_000970323.1.56830 WP_000970323.1.56835 WP_000970323.1.56846 WP_000970323.1.56882 WP_000970323.1.56908 WP_000970323.1.56937 WP_000970323.1.56951 WP_000970323.1.56978 WP_000970323.1.56980 WP_000970323.1.56992 WP_000970323.1.57051 WP_000970323.1.57072 WP_000970323.1.57086 WP_000970323.1.57124 WP_000970323.1.57150 WP_000970323.1.57181 WP_000970323.1.57216 WP_000970323.1.57222 WP_000970323.1.57254 WP_000970323.1.57269 WP_000970323.1.57281 WP_000970323.1.57319 WP_000970323.1.57348 WP_000970323.1.57349 WP_000970323.1.57386 WP_000970323.1.57401 WP_000970323.1.57403 WP_000970323.1.57410 WP_000970323.1.57414 WP_000970323.1.57432 WP_000970323.1.5748 WP_000970323.1.57487 WP_000970323.1.57538 WP_000970323.1.5755 WP_000970323.1.57558 WP_000970323.1.57574 WP_000970323.1.57588 WP_000970323.1.57628 WP_000970323.1.57634 WP_000970323.1.57659 WP_000970323.1.57663 WP_000970323.1.57669 WP_000970323.1.57738 WP_000970323.1.57812 WP_000970323.1.57846 WP_000970323.1.5786 WP_000970323.1.57898 WP_000970323.1.57903 WP_000970323.1.57920 WP_000970323.1.57951 WP_000970323.1.57975 WP_000970323.1.58001 WP_000970323.1.58022 WP_000970323.1.58045 WP_000970323.1.58060 WP_000970323.1.5810 WP_000970323.1.58128 WP_000970323.1.58146 WP_000970323.1.58163 WP_000970323.1.58172 WP_000970323.1.58206 WP_000970323.1.58226 WP_000970323.1.58232 WP_000970323.1.58289 WP_000970323.1.58368 WP_000970323.1.58384 WP_000970323.1.58401 WP_000970323.1.58408 WP_000970323.1.58429 WP_000970323.1.58440 WP_000970323.1.58445 WP_000970323.1.58475 WP_000970323.1.58496 WP_000970323.1.58507 WP_000970323.1.58528 WP_000970323.1.58547 WP_000970323.1.58572 WP_000970323.1.58622 WP_000970323.1.58680 WP_000970323.1.58705 WP_000970323.1.58837 WP_000970323.1.58867 WP_000970323.1.58870 WP_000970323.1.58901 WP_000970323.1.58940 WP_000970323.1.58942 WP_000970323.1.58951 WP_000970323.1.58958 WP_000970323.1.58976 WP_000970323.1.58977 WP_000970323.1.58983 WP_000970323.1.59024 WP_000970323.1.59047 WP_000970323.1.59119 WP_000970323.1.59165 WP_000970323.1.59174 WP_000970323.1.59190 WP_000970323.1.59199 WP_000970323.1.59218 WP_000970323.1.59226 WP_000970323.1.59293 WP_000970323.1.59306 WP_000970323.1.59395 WP_000970323.1.59396 WP_000970323.1.59407 WP_000970323.1.59409 WP_000970323.1.59413 WP_000970323.1.59423 WP_000970323.1.59513 WP_000970323.1.59533 WP_000970323.1.59553 WP_000970323.1.59590 WP_000970323.1.59615 WP_000970323.1.59621 WP_000970323.1.5965 WP_000970323.1.59689 WP_000970323.1.59699 WP_000970323.1.597 WP_000970323.1.59717 WP_000970323.1.59730 WP_000970323.1.59737 WP_000970323.1.59756 WP_000970323.1.59781 WP_000970323.1.59782 WP_000970323.1.59791 WP_000970323.1.59823 WP_000970323.1.59836 WP_000970323.1.59855 WP_000970323.1.59877 WP_000970323.1.5990 WP_000970323.1.59914 WP_000970323.1.59989 WP_000970323.1.59998 WP_000970323.1.60005 WP_000970323.1.6002 WP_000970323.1.60031 WP_000970323.1.60067 WP_000970323.1.60070 WP_000970323.1.60095 WP_000970323.1.60151 WP_000970323.1.60186 WP_000970323.1.60228 WP_000970323.1.60246 WP_000970323.1.60325 WP_000970323.1.60342 WP_000970323.1.60343 WP_000970323.1.60436 WP_000970323.1.60443 WP_000970323.1.60491 WP_000970323.1.60498 WP_000970323.1.60505 WP_000970323.1.60550 WP_000970323.1.60559 WP_000970323.1.60567 WP_000970323.1.60570 WP_000970323.1.60576 WP_000970323.1.6059 WP_000970323.1.60599 WP_000970323.1.60606 WP_000970323.1.6061 WP_000970323.1.60614 WP_000970323.1.60644 WP_000970323.1.6066 WP_000970323.1.60671 WP_000970323.1.60684 WP_000970323.1.60698 WP_000970323.1.60717 WP_000970323.1.60732 WP_000970323.1.60764 WP_000970323.1.60771 WP_000970323.1.60805 WP_000970323.1.60816 WP_000970323.1.60826 WP_000970323.1.60835 WP_000970323.1.60847 WP_000970323.1.60895 WP_000970323.1.60901 WP_000970323.1.60921 WP_000970323.1.60925 WP_000970323.1.60927 WP_000970323.1.6094 WP_000970323.1.60974 WP_000970323.1.61008 WP_000970323.1.61035 WP_000970323.1.61046 WP_000970323.1.61058 WP_000970323.1.6106 WP_000970323.1.61096 WP_000970323.1.6110 WP_000970323.1.61112 WP_000970323.1.61148 WP_000970323.1.61170 WP_000970323.1.61174 WP_000970323.1.61181 WP_000970323.1.61183 WP_000970323.1.61223 WP_000970323.1.61241 WP_000970323.1.61268 WP_000970323.1.61292 WP_000970323.1.61362 WP_000970323.1.61373 WP_000970323.1.61398 WP_000970323.1.61505 WP_000970323.1.61512 WP_000970323.1.61517 WP_000970323.1.61524 WP_000970323.1.61551 WP_000970323.1.61608 WP_000970323.1.61612 WP_000970323.1.61636 WP_000970323.1.61643 WP_000970323.1.61663 WP_000970323.1.61703 WP_000970323.1.61718 WP_000970323.1.61770 WP_000970323.1.61779 WP_000970323.1.61822 WP_000970323.1.61853 WP_000970323.1.61858 WP_000970323.1.61893 WP_000970323.1.61926 WP_000970323.1.61939 WP_000970323.1.61948 WP_000970323.1.61949 WP_000970323.1.61955 WP_000970323.1.61957 WP_000970323.1.61966 WP_000970323.1.62041 WP_000970323.1.62099 WP_000970323.1.62264 WP_000970323.1.62282 WP_000970323.1.62296 WP_000970323.1.62303 WP_000970323.1.62337 WP_000970323.1.62348 WP_000970323.1.62358 WP_000970323.1.62447 WP_000970323.1.6245 WP_000970323.1.62460 WP_000970323.1.62507 WP_000970323.1.62513 WP_000970323.1.62514 WP_000970323.1.62529 WP_000970323.1.62612 WP_000970323.1.62646 WP_000970323.1.62681 WP_000970323.1.62714 WP_000970323.1.62735 WP_000970323.1.62750 WP_000970323.1.62762 WP_000970323.1.62769 WP_000970323.1.62787 WP_000970323.1.62802 WP_000970323.1.62812 WP_000970323.1.62818 WP_000970323.1.62840 WP_000970323.1.62850 WP_000970323.1.62914 WP_000970323.1.62919 WP_000970323.1.6293 WP_000970323.1.62959 WP_000970323.1.62973 WP_000970323.1.62989 WP_000970323.1.6299 WP_000970323.1.62992 WP_000970323.1.63023 WP_000970323.1.63167 WP_000970323.1.63177 WP_000970323.1.63189 WP_000970323.1.63246 WP_000970323.1.63287 WP_000970323.1.6334 WP_000970323.1.63350 WP_000970323.1.6337 WP_000970323.1.63370 WP_000970323.1.63374 WP_000970323.1.63437 WP_000970323.1.63453 WP_000970323.1.63466 WP_000970323.1.63467 WP_000970323.1.63470 WP_000970323.1.63478 WP_000970323.1.63484 WP_000970323.1.63536 WP_000970323.1.63556 WP_000970323.1.63602 WP_000970323.1.63612 WP_000970323.1.63666 WP_000970323.1.63679 WP_000970323.1.63683 WP_000970323.1.63703 WP_000970323.1.63721 WP_000970323.1.63746 WP_000970323.1.63800 WP_000970323.1.63871 WP_000970323.1.63964 WP_000970323.1.64008 WP_000970323.1.64014 WP_000970323.1.64040 WP_000970323.1.64050 WP_000970323.1.64074 WP_000970323.1.64150 WP_000970323.1.64153 WP_000970323.1.6416 WP_000970323.1.64175 WP_000970323.1.64193 WP_000970323.1.64280 WP_000970323.1.64285 WP_000970323.1.64286 WP_000970323.1.6431 WP_000970323.1.64321 WP_000970323.1.64337 WP_000970323.1.64353 WP_000970323.1.64356 WP_000970323.1.64437 WP_000970323.1.64448 WP_000970323.1.64519 WP_000970323.1.64528 WP_000970323.1.64540 WP_000970323.1.64563 WP_000970323.1.64634 WP_000970323.1.6469 WP_000970323.1.64693 WP_000970323.1.647 WP_000970323.1.64707 WP_000970323.1.64749 WP_000970323.1.64784 WP_000970323.1.64789 WP_000970323.1.64793 WP_000970323.1.64866 WP_000970323.1.64881 WP_000970323.1.64895 WP_000970323.1.64912 WP_000970323.1.64930 WP_000970323.1.64939 WP_000970323.1.64970 WP_000970323.1.6499 WP_000970323.1.65040 WP_000970323.1.65056 WP_000970323.1.65097 WP_000970323.1.651 WP_000970323.1.65110 WP_000970323.1.65135 WP_000970323.1.65151 WP_000970323.1.65155 WP_000970323.1.65179 WP_000970323.1.65192 WP_000970323.1.65206 WP_000970323.1.65271 WP_000970323.1.65296 WP_000970323.1.65305 WP_000970323.1.65306 WP_000970323.1.65353 WP_000970323.1.65364 WP_000970323.1.6537 WP_000970323.1.65370 WP_000970323.1.654 WP_000970323.1.65408 WP_000970323.1.65413 WP_000970323.1.65415 WP_000970323.1.65484 WP_000970323.1.65493 WP_000970323.1.6553 WP_000970323.1.65531 WP_000970323.1.65581 WP_000970323.1.65596 WP_000970323.1.65667 WP_000970323.1.65672 WP_000970323.1.65677 WP_000970323.1.65708 WP_000970323.1.65714 WP_000970323.1.65762 WP_000970323.1.65912 WP_000970323.1.65954 WP_000970323.1.65961 WP_000970323.1.65962 WP_000970323.1.66001 WP_000970323.1.66050 WP_000970323.1.66059 WP_000970323.1.66094 WP_000970323.1.66102 WP_000970323.1.66104 WP_000970323.1.66105 WP_000970323.1.66127 WP_000970323.1.66187 WP_000970323.1.66197 WP_000970323.1.6622 WP_000970323.1.66264 WP_000970323.1.66288 WP_000970323.1.66327 WP_000970323.1.6635 WP_000970323.1.66387 WP_000970323.1.66395 WP_000970323.1.66412 WP_000970323.1.66432 WP_000970323.1.66501 WP_000970323.1.6654 WP_000970323.1.66550 WP_000970323.1.66579 WP_000970323.1.6665 WP_000970323.1.66700 WP_000970323.1.66719 WP_000970323.1.6676 WP_000970323.1.66783 WP_000970323.1.66791 WP_000970323.1.66795 WP_000970323.1.66849 WP_000970323.1.66933 WP_000970323.1.66948 WP_000970323.1.66975 WP_000970323.1.66978 WP_000970323.1.6701 WP_000970323.1.67018 WP_000970323.1.67021 WP_000970323.1.67022 WP_000970323.1.67026 WP_000970323.1.67102 WP_000970323.1.67116 WP_000970323.1.67120 WP_000970323.1.67137 WP_000970323.1.67149 WP_000970323.1.67193 WP_000970323.1.67209 WP_000970323.1.6723 WP_000970323.1.67272 WP_000970323.1.67278 WP_000970323.1.67293 WP_000970323.1.6735 WP_000970323.1.67383 WP_000970323.1.67412 WP_000970323.1.67415 WP_000970323.1.67454 WP_000970323.1.67462 WP_000970323.1.67467 WP_000970323.1.67468 WP_000970323.1.67522 WP_000970323.1.67538 WP_000970323.1.67549 WP_000970323.1.67553 WP_000970323.1.67581 WP_000970323.1.67660 WP_000970323.1.67663 WP_000970323.1.67701 WP_000970323.1.67704 WP_000970323.1.67724 WP_000970323.1.67732 WP_000970323.1.67786 WP_000970323.1.67787 WP_000970323.1.67788 WP_000970323.1.67802 WP_000970323.1.67853 WP_000970323.1.67861 WP_000970323.1.67901 WP_000970323.1.67938 WP_000970323.1.67975 WP_000970323.1.67984 WP_000970323.1.67990 WP_000970323.1.67999 WP_000970323.1.68008 WP_000970323.1.6802 WP_000970323.1.68025 WP_000970323.1.6803 WP_000970323.1.68039 WP_000970323.1.68053 WP_000970323.1.68067 WP_000970323.1.68069 WP_000970323.1.68079 WP_000970323.1.68126 WP_000970323.1.6814 WP_000970323.1.68145 WP_000970323.1.68170 WP_000970323.1.682 WP_000970323.1.68215 WP_000970323.1.68241 WP_000970323.1.68255 WP_000970323.1.68271 WP_000970323.1.68281 WP_000970323.1.68300 WP_000970323.1.68336 WP_000970323.1.68341 WP_000970323.1.68347 WP_000970323.1.68369 WP_000970323.1.68396 WP_000970323.1.68442 WP_000970323.1.68482 WP_000970323.1.68490 WP_000970323.1.68534 WP_000970323.1.68584 WP_000970323.1.68598 WP_000970323.1.6860 WP_000970323.1.68609 WP_000970323.1.68630 WP_000970323.1.68635 WP_000970323.1.68673 WP_000970323.1.68678 WP_000970323.1.68697 WP_000970323.1.68711 WP_000970323.1.68751 WP_000970323.1.68752 WP_000970323.1.6877 WP_000970323.1.68797 WP_000970323.1.68801 WP_000970323.1.68865 WP_000970323.1.68880 WP_000970323.1.68915 WP_000970323.1.68961 WP_000970323.1.6897 WP_000970323.1.68989 WP_000970323.1.69033 WP_000970323.1.69039 WP_000970323.1.69098 WP_000970323.1.69127 WP_000970323.1.69144 WP_000970323.1.6916 WP_000970323.1.6919 WP_000970323.1.69192 WP_000970323.1.6923 WP_000970323.1.69258 WP_000970323.1.69261 WP_000970323.1.6929 WP_000970323.1.69303 WP_000970323.1.69305 WP_000970323.1.69404 WP_000970323.1.69441 WP_000970323.1.69472 WP_000970323.1.69473 WP_000970323.1.69537 WP_000970323.1.69551 WP_000970323.1.69593 WP_000970323.1.69596 WP_000970323.1.69646 WP_000970323.1.69649 WP_000970323.1.69689 WP_000970323.1.69730 WP_000970323.1.69786 WP_000970323.1.69803 WP_000970323.1.69868 WP_000970323.1.69887 WP_000970323.1.6993 WP_000970323.1.69972 WP_000970323.1.69979 WP_000970323.1.70063 WP_000970323.1.70081 WP_000970323.1.70149 WP_000970323.1.70190 WP_000970323.1.70191 WP_000970323.1.70213 WP_000970323.1.70251 WP_000970323.1.70341 WP_000970323.1.70357 WP_000970323.1.70370 WP_000970323.1.70407 WP_000970323.1.70477 WP_000970323.1.70492 WP_000970323.1.70509 WP_000970323.1.70530 WP_000970323.1.70578 WP_000970323.1.70582 WP_000970323.1.70592 WP_000970323.1.70600 WP_000970323.1.70628 WP_000970323.1.70694 WP_000970323.1.70698 WP_000970323.1.70728 WP_000970323.1.70745 WP_000970323.1.70767 WP_000970323.1.70794 WP_000970323.1.70801 WP_000970323.1.7090 WP_000970323.1.70900 WP_000970323.1.71024 WP_000970323.1.71037 WP_000970323.1.71042 WP_000970323.1.71062 WP_000970323.1.71109 WP_000970323.1.71113 WP_000970323.1.71134 WP_000970323.1.71147 WP_000970323.1.71159 WP_000970323.1.71162 WP_000970323.1.71170 WP_000970323.1.71176 WP_000970323.1.71192 WP_000970323.1.71199 WP_000970323.1.71223 WP_000970323.1.71229 WP_000970323.1.71264 WP_000970323.1.71272 WP_000970323.1.71273 WP_000970323.1.71275 WP_000970323.1.71285 WP_000970323.1.71312 WP_000970323.1.71315 WP_000970323.1.71323 WP_000970323.1.71327 WP_000970323.1.71339 WP_000970323.1.71397 WP_000970323.1.71403 WP_000970323.1.71409 WP_000970323.1.7147 WP_000970323.1.71480 WP_000970323.1.71522 WP_000970323.1.71533 WP_000970323.1.71540 WP_000970323.1.71560 WP_000970323.1.71603 WP_000970323.1.71680 WP_000970323.1.71690 WP_000970323.1.71724 WP_000970323.1.71757 WP_000970323.1.71767 WP_000970323.1.71783 WP_000970323.1.71832 WP_000970323.1.71837 WP_000970323.1.71856 WP_000970323.1.71874 WP_000970323.1.71922 WP_000970323.1.71938 WP_000970323.1.71944 WP_000970323.1.71945 WP_000970323.1.71975 WP_000970323.1.71987 WP_000970323.1.71993 WP_000970323.1.72013 WP_000970323.1.72021 WP_000970323.1.72033 WP_000970323.1.7205 WP_000970323.1.72053 WP_000970323.1.72054 WP_000970323.1.7210 WP_000970323.1.72120 WP_000970323.1.72125 WP_000970323.1.72126 WP_000970323.1.72141 WP_000970323.1.72155 WP_000970323.1.72157 WP_000970323.1.72184 WP_000970323.1.72237 WP_000970323.1.72240 WP_000970323.1.7225 WP_000970323.1.72262 WP_000970323.1.72270 WP_000970323.1.72279 WP_000970323.1.72293 WP_000970323.1.72337 WP_000970323.1.72342 WP_000970323.1.72362 WP_000970323.1.72391 WP_000970323.1.72392 WP_000970323.1.72397 WP_000970323.1.72414 WP_000970323.1.72431 WP_000970323.1.72449 WP_000970323.1.72485 WP_000970323.1.72493 WP_000970323.1.72511 WP_000970323.1.72521 WP_000970323.1.72522 WP_000970323.1.72535 WP_000970323.1.72537 WP_000970323.1.72544 WP_000970323.1.72574 WP_000970323.1.72582 WP_000970323.1.72593 WP_000970323.1.72606 WP_000970323.1.72615 WP_000970323.1.72616 WP_000970323.1.72643 WP_000970323.1.72651 WP_000970323.1.72652 WP_000970323.1.72738 WP_000970323.1.72745 WP_000970323.1.72747 WP_000970323.1.72748 WP_000970323.1.72751 WP_000970323.1.7277 WP_000970323.1.72778 WP_000970323.1.72804 WP_000970323.1.72806 WP_000970323.1.72858 WP_000970323.1.72860 WP_000970323.1.72869 WP_000970323.1.72910 WP_000970323.1.72947 WP_000970323.1.72956 WP_000970323.1.72998 WP_000970323.1.73010 WP_000970323.1.73015 WP_000970323.1.73032 WP_000970323.1.7307 WP_000970323.1.73075 WP_000970323.1.73085 WP_000970323.1.73129 WP_000970323.1.73193 WP_000970323.1.73197 WP_000970323.1.73217 WP_000970323.1.73239 WP_000970323.1.73249 WP_000970323.1.73251 WP_000970323.1.73257 WP_000970323.1.73278 WP_000970323.1.73292 WP_000970323.1.73295 WP_000970323.1.73326 WP_000970323.1.73340 WP_000970323.1.73385 WP_000970323.1.73393 WP_000970323.1.73428 WP_000970323.1.73468 WP_000970323.1.7349 WP_000970323.1.73498 WP_000970323.1.73524 WP_000970323.1.73592 WP_000970323.1.73604 WP_000970323.1.73631 WP_000970323.1.73652 WP_000970323.1.73663 WP_000970323.1.73700 WP_000970323.1.73709 WP_000970323.1.73717 WP_000970323.1.73743 WP_000970323.1.73797 WP_000970323.1.73811 WP_000970323.1.73827 WP_000970323.1.73835 WP_000970323.1.73843 WP_000970323.1.73844 WP_000970323.1.73859 WP_000970323.1.73882 WP_000970323.1.73908 WP_000970323.1.73942 WP_000970323.1.73980 WP_000970323.1.73992 WP_000970323.1.73995 WP_000970323.1.74053 WP_000970323.1.7411 WP_000970323.1.74123 WP_000970323.1.7413 WP_000970323.1.74184 WP_000970323.1.74213 WP_000970323.1.74223 WP_000970323.1.7424 WP_000970323.1.74243 WP_000970323.1.74294 WP_000970323.1.74309 WP_000970323.1.74365 WP_000970323.1.74423 WP_000970323.1.74431 WP_000970323.1.74444 WP_000970323.1.74445 WP_000970323.1.74465 WP_000970323.1.74478 WP_000970323.1.74491 WP_000970323.1.74501 WP_000970323.1.74509 WP_000970323.1.74513 WP_000970323.1.74520 WP_000970323.1.74528 WP_000970323.1.74532 WP_000970323.1.7461 WP_000970323.1.74624 WP_000970323.1.74652 WP_000970323.1.74688 WP_000970323.1.74689 WP_000970323.1.74691 WP_000970323.1.74705 WP_000970323.1.7471 WP_000970323.1.74713 WP_000970323.1.74716 WP_000970323.1.74735 WP_000970323.1.7475 WP_000970323.1.74752 WP_000970323.1.7479 WP_000970323.1.74793 WP_000970323.1.74844 WP_000970323.1.74852 WP_000970323.1.74854 WP_000970323.1.74860 WP_000970323.1.74867 WP_000970323.1.74873 WP_000970323.1.74879 WP_000970323.1.74885 WP_000970323.1.74889 WP_000970323.1.74895 WP_000970323.1.74914 WP_000970323.1.74962 WP_000970323.1.74975 WP_000970323.1.74993 WP_000970323.1.74998 WP_000970323.1.75003 WP_000970323.1.75021 WP_000970323.1.75050 WP_000970323.1.75112 WP_000970323.1.75124 WP_000970323.1.75136 WP_000970323.1.75138 WP_000970323.1.75143 WP_000970323.1.75145 WP_000970323.1.75149 WP_000970323.1.75155 WP_000970323.1.75181 WP_000970323.1.75209 WP_000970323.1.75219 WP_000970323.1.75221 WP_000970323.1.75243 WP_000970323.1.75247 WP_000970323.1.75254 WP_000970323.1.75272 WP_000970323.1.75435 WP_000970323.1.75491 WP_000970323.1.75505 WP_000970323.1.75515 WP_000970323.1.75537 WP_000970323.1.75568 WP_000970323.1.75588 WP_000970323.1.75594 WP_000970323.1.75602 WP_000970323.1.75612 WP_000970323.1.75629 WP_000970323.1.75644 WP_000970323.1.75672 WP_000970323.1.75676 WP_000970323.1.75679 WP_000970323.1.75687 WP_000970323.1.75696 WP_000970323.1.75698 WP_000970323.1.75699 WP_000970323.1.75758 WP_000970323.1.75803 WP_000970323.1.75853 WP_000970323.1.75995 WP_000970323.1.75999 WP_000970323.1.76005 WP_000970323.1.7603 WP_000970323.1.76036 WP_000970323.1.76089 WP_000970323.1.76103 WP_000970323.1.76118 WP_000970323.1.76129 WP_000970323.1.76184 WP_000970323.1.76196 WP_000970323.1.76211 WP_000970323.1.76312 WP_000970323.1.76325 WP_000970323.1.76361 WP_000970323.1.7637 WP_000970323.1.76376 WP_000970323.1.76387 WP_000970323.1.76446 WP_000970323.1.76447 WP_000970323.1.76452 WP_000970323.1.76460 WP_000970323.1.76462 WP_000970323.1.76466 WP_000970323.1.76542 WP_000970323.1.76544 WP_000970323.1.76547 WP_000970323.1.76562 WP_000970323.1.76595 WP_000970323.1.7661 WP_000970323.1.76612 WP_000970323.1.76619 WP_000970323.1.76656 WP_000970323.1.76701 WP_000970323.1.76705 WP_000970323.1.76815 WP_000970323.1.76884 WP_000970323.1.76909 WP_000970323.1.76918 WP_000970323.1.76933 WP_000970323.1.76957 WP_000970323.1.76965 WP_000970323.1.76966 WP_000970323.1.7699 WP_000970323.1.77015 WP_000970323.1.77022 WP_000970323.1.77109 WP_000970323.1.77120 WP_000970323.1.77147 WP_000970323.1.77162 WP_000970323.1.77163 WP_000970323.1.77175 WP_000970323.1.77198 WP_000970323.1.77214 WP_000970323.1.77258 WP_000970323.1.7728 WP_000970323.1.77284 WP_000970323.1.77288 WP_000970323.1.77291 WP_000970323.1.77358 WP_000970323.1.77391 WP_000970323.1.77448 WP_000970323.1.77452 WP_000970323.1.77462 WP_000970323.1.77471 WP_000970323.1.77495 WP_000970323.1.775 WP_000970323.1.77503 WP_000970323.1.77542 WP_000970323.1.77551 WP_000970323.1.77595 WP_000970323.1.77600 WP_000970323.1.77608 WP_000970323.1.77636 WP_000970323.1.77648 WP_000970323.1.77741 WP_000970323.1.77767 WP_000970323.1.77768 WP_000970323.1.7781 WP_000970323.1.77813 WP_000970323.1.77833 WP_000970323.1.77876 WP_000970323.1.77949 WP_000970323.1.7795 WP_000970323.1.77999 WP_000970323.1.78000 WP_000970323.1.78059 WP_000970323.1.7806 WP_000970323.1.7808 WP_000970323.1.78089 WP_000970323.1.78097 WP_000970323.1.78099 WP_000970323.1.78102 WP_000970323.1.78196 WP_000970323.1.78321 WP_000970323.1.78323 WP_000970323.1.78337 WP_000970323.1.78340 WP_000970323.1.78377 WP_000970323.1.78390 WP_000970323.1.78413 WP_000970323.1.78445 WP_000970323.1.7847 WP_000970323.1.78481 WP_000970323.1.7851 WP_000970323.1.78527 WP_000970323.1.78553 WP_000970323.1.78583 WP_000970323.1.78586 WP_000970323.1.78610 WP_000970323.1.78645 WP_000970323.1.78683 WP_000970323.1.78687 WP_000970323.1.78696 WP_000970323.1.78698 WP_000970323.1.78718 WP_000970323.1.78746 WP_000970323.1.78750 WP_000970323.1.78757 WP_000970323.1.78775 WP_000970323.1.78843 WP_000970323.1.78854 WP_000970323.1.78888 WP_000970323.1.78891 WP_000970323.1.78919 WP_000970323.1.78953 WP_000970323.1.7896 WP_000970323.1.78966 WP_000970323.1.7898 WP_000970323.1.79002 WP_000970323.1.79004 WP_000970323.1.79065 WP_000970323.1.79067 WP_000970323.1.79075 WP_000970323.1.79086 WP_000970323.1.79088 WP_000970323.1.79090 WP_000970323.1.79092 WP_000970323.1.79226 WP_000970323.1.79246 WP_000970323.1.79308 WP_000970323.1.79312 WP_000970323.1.79343 WP_000970323.1.79346 WP_000970323.1.79356 WP_000970323.1.79369 WP_000970323.1.7937 WP_000970323.1.79416 WP_000970323.1.79478 WP_000970323.1.79505 WP_000970323.1.79525 WP_000970323.1.79540 WP_000970323.1.79558 WP_000970323.1.79591 WP_000970323.1.79606 WP_000970323.1.79685 WP_000970323.1.79764 WP_000970323.1.79816 WP_000970323.1.79840 WP_000970323.1.79869 WP_000970323.1.7987 WP_000970323.1.79871 WP_000970323.1.79877 WP_000970323.1.79905 WP_000970323.1.7993 WP_000970323.1.79931 WP_000970323.1.79932 WP_000970323.1.79936 WP_000970323.1.79944 WP_000970323.1.79984 WP_000970323.1.80011 WP_000970323.1.80043 WP_000970323.1.80050 WP_000970323.1.80060 WP_000970323.1.80061 WP_000970323.1.80071 WP_000970323.1.80106 WP_000970323.1.80112 WP_000970323.1.80136 WP_000970323.1.80141 WP_000970323.1.80176 WP_000970323.1.80179 WP_000970323.1.80192 WP_000970323.1.80255 WP_000970323.1.80292 WP_000970323.1.80310 WP_000970323.1.80320 WP_000970323.1.80388 WP_000970323.1.80428 WP_000970323.1.80440 WP_000970323.1.80456 WP_000970323.1.80463 WP_000970323.1.80484 WP_000970323.1.80517 WP_000970323.1.80524 WP_000970323.1.80545 WP_000970323.1.8057 WP_000970323.1.80594 WP_000970323.1.80626 WP_000970323.1.80662 WP_000970323.1.80666 WP_000970323.1.80676 WP_000970323.1.80709 WP_000970323.1.80731 WP_000970323.1.80736 WP_000970323.1.80737 WP_000970323.1.8074 WP_000970323.1.80753 WP_000970323.1.80754 WP_000970323.1.80756 WP_000970323.1.8076 WP_000970323.1.80768 WP_000970323.1.80789 WP_000970323.1.808 WP_000970323.1.80804 WP_000970323.1.80805 WP_000970323.1.80843 WP_000970323.1.80882 WP_000970323.1.80884 WP_000970323.1.80894 WP_000970323.1.8090 WP_000970323.1.8091 WP_000970323.1.80945 WP_000970323.1.80946 WP_000970323.1.80954 WP_000970323.1.80966 WP_000970323.1.810 WP_000970323.1.81026 WP_000970323.1.81034 WP_000970323.1.81036 WP_000970323.1.81054 WP_000970323.1.81071 WP_000970323.1.81127 WP_000970323.1.81165 WP_000970323.1.81180 WP_000970323.1.81182 WP_000970323.1.8121 WP_000970323.1.81281 WP_000970323.1.81283 WP_000970323.1.81286 WP_000970323.1.8129 WP_000970323.1.81298 WP_000970323.1.81376 WP_000970323.1.81438 WP_000970323.1.81469 WP_000970323.1.81475 WP_000970323.1.81484 WP_000970323.1.81517 WP_000970323.1.81580 WP_000970323.1.81582 WP_000970323.1.81589 WP_000970323.1.81602 WP_000970323.1.81618 WP_000970323.1.81688 WP_000970323.1.81692 WP_000970323.1.8172 WP_000970323.1.81723 WP_000970323.1.81806 WP_000970323.1.81819 WP_000970323.1.81832 WP_000970323.1.81876 WP_000970323.1.81881 WP_000970323.1.81935 WP_000970323.1.81939 WP_000970323.1.81952 WP_000970323.1.81956 WP_000970323.1.81972 WP_000970323.1.82 WP_000970323.1.82032 WP_000970323.1.82061 WP_000970323.1.82062 WP_000970323.1.82074 WP_000970323.1.82116 WP_000970323.1.82137 WP_000970323.1.82217 WP_000970323.1.82239 WP_000970323.1.82240 WP_000970323.1.82242 WP_000970323.1.82246 WP_000970323.1.82275 WP_000970323.1.82280 WP_000970323.1.82316 WP_000970323.1.82320 WP_000970323.1.82326 WP_000970323.1.82330 WP_000970323.1.8235 WP_000970323.1.82378 WP_000970323.1.82438 WP_000970323.1.82439 WP_000970323.1.82485 WP_000970323.1.82507 WP_000970323.1.82536 WP_000970323.1.82572 WP_000970323.1.82614 WP_000970323.1.82626 WP_000970323.1.82647 WP_000970323.1.82691 WP_000970323.1.82700 WP_000970323.1.82705 WP_000970323.1.82715 WP_000970323.1.82718 WP_000970323.1.82754 WP_000970323.1.8277 WP_000970323.1.82780 WP_000970323.1.82799 WP_000970323.1.82831 WP_000970323.1.82853 WP_000970323.1.83020 WP_000970323.1.83033 WP_000970323.1.83035 WP_000970323.1.83051 WP_000970323.1.8306 WP_000970323.1.8308 WP_000970323.1.83097 WP_000970323.1.83160 WP_000970323.1.83177 WP_000970323.1.83205 WP_000970323.1.83224 WP_000970323.1.83286 WP_000970323.1.83321 WP_000970323.1.83330 WP_000970323.1.83340 WP_000970323.1.83347 WP_000970323.1.83415 WP_000970323.1.83466 WP_000970323.1.83584 WP_000970323.1.83735 WP_000970323.1.83781 WP_000970323.1.83807 WP_000970323.1.83820 WP_000970323.1.83941 WP_000970323.1.83947 WP_000970323.1.84004 WP_000970323.1.84074 WP_000970323.1.8411 WP_000970323.1.84140 WP_000970323.1.84164 WP_000970323.1.84172 WP_000970323.1.84185 WP_000970323.1.84298 WP_000970323.1.84313 WP_000970323.1.84331 WP_000970323.1.84348 WP_000970323.1.84405 WP_000970323.1.84410 WP_000970323.1.84436 WP_000970323.1.8444 WP_000970323.1.84462 WP_000970323.1.84467 WP_000970323.1.84473 WP_000970323.1.84511 WP_000970323.1.84518 WP_000970323.1.84534 WP_000970323.1.84584 WP_000970323.1.84656 WP_000970323.1.84675 WP_000970323.1.84697 WP_000970323.1.84738 WP_000970323.1.84740 WP_000970323.1.84768 WP_000970323.1.84841 WP_000970323.1.84850 WP_000970323.1.84875 WP_000970323.1.84878 WP_000970323.1.84881 WP_000970323.1.84893 WP_000970323.1.84894 WP_000970323.1.84916 WP_000970323.1.84929 WP_000970323.1.84941 WP_000970323.1.84972 WP_000970323.1.84977 WP_000970323.1.84986 WP_000970323.1.84989 WP_000970323.1.84990 WP_000970323.1.84994 WP_000970323.1.85002 WP_000970323.1.85008 WP_000970323.1.85011 WP_000970323.1.85085 WP_000970323.1.85090 WP_000970323.1.85098 WP_000970323.1.85112 WP_000970323.1.85141 WP_000970323.1.85156 WP_000970323.1.85175 WP_000970323.1.85216 WP_000970323.1.85247 WP_000970323.1.85255 WP_000970323.1.85260 WP_000970323.1.85305 WP_000970323.1.85310 WP_000970323.1.85323 WP_000970323.1.85335 WP_000970323.1.85342 WP_000970323.1.85369 WP_000970323.1.85385 WP_000970323.1.85416 WP_000970323.1.85435 WP_000970323.1.85500 WP_000970323.1.85525 WP_000970323.1.85546 WP_000970323.1.85563 WP_000970323.1.85601 WP_000970323.1.85621 WP_000970323.1.85657 WP_000970323.1.85685 WP_000970323.1.85752 WP_000970323.1.85762 WP_000970323.1.85767 WP_000970323.1.85773 WP_000970323.1.8579 WP_000970323.1.85793 WP_000970323.1.85800 WP_000970323.1.85806 WP_000970323.1.85857 WP_000970323.1.85895 WP_000970323.1.8592 WP_000970323.1.85939 WP_000970323.1.85948 WP_000970323.1.85969 WP_000970323.1.86 WP_000970323.1.86001 WP_000970323.1.86016 WP_000970323.1.86063 WP_000970323.1.8607 WP_000970323.1.86110 WP_000970323.1.86115 WP_000970323.1.86145 WP_000970323.1.86149 WP_000970323.1.86161 WP_000970323.1.86181 WP_000970323.1.86189 WP_000970323.1.8621 WP_000970323.1.86210 WP_000970323.1.86228 WP_000970323.1.86263 WP_000970323.1.86266 WP_000970323.1.86276 WP_000970323.1.86280 WP_000970323.1.86283 WP_000970323.1.86307 WP_000970323.1.8635 WP_000970323.1.86355 WP_000970323.1.86364 WP_000970323.1.86371 WP_000970323.1.86376 WP_000970323.1.86393 WP_000970323.1.86411 WP_000970323.1.86412 WP_000970323.1.86451 WP_000970323.1.86452 WP_000970323.1.86454 WP_000970323.1.86461 WP_000970323.1.86475 WP_000970323.1.86483 WP_000970323.1.86492 WP_000970323.1.8652 WP_000970323.1.86583 WP_000970323.1.86598 WP_000970323.1.86609 WP_000970323.1.86617 WP_000970323.1.86640 WP_000970323.1.86674 WP_000970323.1.86691 WP_000970323.1.86707 WP_000970323.1.86717 WP_000970323.1.86760 WP_000970323.1.86787 WP_000970323.1.86833 WP_000970323.1.86846 WP_000970323.1.86848 WP_000970323.1.8687 WP_000970323.1.86935 WP_000970323.1.86956 WP_000970323.1.86959 WP_000970323.1.86975 WP_000970323.1.87059 WP_000970323.1.87075 WP_000970323.1.87109 WP_000970323.1.8711 WP_000970323.1.87177 WP_000970323.1.87189 WP_000970323.1.87199 WP_000970323.1.87249 WP_000970323.1.87310 WP_000970323.1.87339 WP_000970323.1.87389 WP_000970323.1.87465 WP_000970323.1.87563 WP_000970323.1.87568 WP_000970323.1.87574 WP_000970323.1.87607 WP_000970323.1.87608 WP_000970323.1.87639 WP_000970323.1.87655 WP_000970323.1.87694 WP_000970323.1.8771 WP_000970323.1.87726 WP_000970323.1.87788 WP_000970323.1.87822 WP_000970323.1.87834 WP_000970323.1.87857 WP_000970323.1.87914 WP_000970323.1.87976 WP_000970323.1.87980 WP_000970323.1.87984 WP_000970323.1.87989 WP_000970323.1.880 WP_000970323.1.88017 WP_000970323.1.88066 WP_000970323.1.88088 WP_000970323.1.88155 WP_000970323.1.88189 WP_000970323.1.88238 WP_000970323.1.88252 WP_000970323.1.88285 WP_000970323.1.88301 WP_000970323.1.88304 WP_000970323.1.88352 WP_000970323.1.88376 WP_000970323.1.88384 WP_000970323.1.88413 WP_000970323.1.88427 WP_000970323.1.88434 WP_000970323.1.88438 WP_000970323.1.88462 WP_000970323.1.88539 WP_000970323.1.8854 WP_000970323.1.88557 WP_000970323.1.88577 WP_000970323.1.88598 WP_000970323.1.88603 WP_000970323.1.88607 WP_000970323.1.88631 WP_000970323.1.88646 WP_000970323.1.88667 WP_000970323.1.88678 WP_000970323.1.88685 WP_000970323.1.88720 WP_000970323.1.88729 WP_000970323.1.88732 WP_000970323.1.88735 WP_000970323.1.88757 WP_000970323.1.88759 WP_000970323.1.8879 WP_000970323.1.88834 WP_000970323.1.88864 WP_000970323.1.88883 WP_000970323.1.88950 WP_000970323.1.88997 WP_000970323.1.89018 WP_000970323.1.89050 WP_000970323.1.89067 WP_000970323.1.89090 WP_000970323.1.89099 WP_000970323.1.89111 WP_000970323.1.89165 WP_000970323.1.89183 WP_000970323.1.89200 WP_000970323.1.89255 WP_000970323.1.8928 WP_000970323.1.89305 WP_000970323.1.894 WP_000970323.1.89400 WP_000970323.1.89403 WP_000970323.1.89416 WP_000970323.1.89458 WP_000970323.1.89468 WP_000970323.1.89471 WP_000970323.1.89474 WP_000970323.1.89479 WP_000970323.1.89492 WP_000970323.1.89510 WP_000970323.1.89605 WP_000970323.1.89630 WP_000970323.1.89646 WP_000970323.1.89656 WP_000970323.1.89674 WP_000970323.1.89679 WP_000970323.1.89710 WP_000970323.1.89788 WP_000970323.1.89818 WP_000970323.1.89839 WP_000970323.1.89841 WP_000970323.1.8985 WP_000970323.1.89895 WP_000970323.1.89899 WP_000970323.1.89915 WP_000970323.1.89918 WP_000970323.1.89923 WP_000970323.1.89925 WP_000970323.1.89927 WP_000970323.1.89998 WP_000970323.1.90017 WP_000970323.1.90065 WP_000970323.1.90078 WP_000970323.1.9009 WP_000970323.1.9010 WP_000970323.1.90115 WP_000970323.1.90128 WP_000970323.1.90146 WP_000970323.1.90156 WP_000970323.1.90168 WP_000970323.1.90182 WP_000970323.1.90205 WP_000970323.1.90249 WP_000970323.1.90256 WP_000970323.1.90266 WP_000970323.1.90270 WP_000970323.1.90314 WP_000970323.1.90332 WP_000970323.1.90358 WP_000970323.1.9036 WP_000970323.1.90389 WP_000970323.1.90405 WP_000970323.1.90435 WP_000970323.1.90436 WP_000970323.1.90441 WP_000970323.1.90511 WP_000970323.1.90520 WP_000970323.1.90536 WP_000970323.1.90591 WP_000970323.1.9061 WP_000970323.1.90703 WP_000970323.1.90706 WP_000970323.1.90758 WP_000970323.1.9081 WP_000970323.1.90813 WP_000970323.1.90828 WP_000970323.1.90834 WP_000970323.1.90839 WP_000970323.1.9084 WP_000970323.1.90856 WP_000970323.1.90865 WP_000970323.1.90890 WP_000970323.1.90924 WP_000970323.1.90951 WP_000970323.1.91 WP_000970323.1.91018 WP_000970323.1.91094 WP_000970323.1.91117 WP_000970323.1.91138 WP_000970323.1.91170 WP_000970323.1.9118 WP_000970323.1.91266 WP_000970323.1.91268 WP_000970323.1.91277 WP_000970323.1.91290 WP_000970323.1.91340 WP_000970323.1.91341 WP_000970323.1.91397 WP_000970323.1.91414 WP_000970323.1.91445 WP_000970323.1.91462 WP_000970323.1.91485 WP_000970323.1.91511 WP_000970323.1.91526 WP_000970323.1.91551 WP_000970323.1.9157 WP_000970323.1.91594 WP_000970323.1.91596 WP_000970323.1.9160 WP_000970323.1.91630 WP_000970323.1.91640 WP_000970323.1.91643 WP_000970323.1.91644 WP_000970323.1.91672 WP_000970323.1.9169 WP_000970323.1.91701 WP_000970323.1.91739 WP_000970323.1.91777 WP_000970323.1.91779 WP_000970323.1.91782 WP_000970323.1.91787 WP_000970323.1.91793 WP_000970323.1.9185 WP_000970323.1.91850 WP_000970323.1.91863 WP_000970323.1.91879 WP_000970323.1.91951 WP_000970323.1.91971 WP_000970323.1.91994 WP_000970323.1.92019 WP_000970323.1.92029 WP_000970323.1.92031 WP_000970323.1.921 WP_000970323.1.92102 WP_000970323.1.92114 WP_000970323.1.92123 WP_000970323.1.9215 WP_000970323.1.92161 WP_000970323.1.92163 WP_000970323.1.92195 WP_000970323.1.92215 WP_000970323.1.92311 WP_000970323.1.92361 WP_000970323.1.924 WP_000970323.1.92434 WP_000970323.1.92462 WP_000970323.1.92495 WP_000970323.1.92496 WP_000970323.1.92506 WP_000970323.1.9255 WP_000970323.1.92571 WP_000970323.1.92614 WP_000970323.1.92615 WP_000970323.1.9264 WP_000970323.1.9266 WP_000970323.1.92668 WP_000970323.1.92708 WP_000970323.1.92719 WP_000970323.1.92742 WP_000970323.1.92781 WP_000970323.1.92792 WP_000970323.1.92793 WP_000970323.1.92796 WP_000970323.1.92845 WP_000970323.1.92865 WP_000970323.1.92932 WP_000970323.1.92953 WP_000970323.1.92989 WP_000970323.1.92991 WP_000970323.1.93005 WP_000970323.1.93019 WP_000970323.1.93033 WP_000970323.1.93048 WP_000970323.1.93054 WP_000970323.1.93085 WP_000970323.1.93100 WP_000970323.1.93133 WP_000970323.1.93150 WP_000970323.1.93175 WP_000970323.1.93252 WP_000970323.1.93267 WP_000970323.1.93276 WP_000970323.1.93309 WP_000970323.1.93312 WP_000970323.1.93338 WP_000970323.1.93379 WP_000970323.1.93463 WP_000970323.1.93468 WP_000970323.1.93509 WP_000970323.1.93531 WP_000970323.1.93605 WP_000970323.1.93621 WP_000970323.1.93626 WP_000970323.1.93637 WP_000970323.1.93665 WP_000970323.1.93673 WP_000970323.1.93733 WP_000970323.1.93742 WP_000970323.1.93745 WP_000970323.1.93755 WP_000970323.1.938 WP_000970323.1.93800 WP_000970323.1.93873 WP_000970323.1.939 WP_000970323.1.93900 WP_000970323.1.93911 WP_000970323.1.93921 WP_000970323.1.93951 WP_000970323.1.94008 WP_000970323.1.94011 WP_000970323.1.94025 WP_000970323.1.94057 WP_000970323.1.94156 WP_000970323.1.94176 WP_000970323.1.94190 WP_000970323.1.94271 WP_000970323.1.94298 WP_000970323.1.94317 WP_000970323.1.94353 WP_000970323.1.94388 WP_000970323.1.94404 WP_000970323.1.94429 WP_000970323.1.94445 WP_000970323.1.94468 WP_000970323.1.94475 WP_000970323.1.94497 WP_000970323.1.94507 WP_000970323.1.94516 WP_000970323.1.94523 WP_000970323.1.94542 WP_000970323.1.94548 WP_000970323.1.9457 WP_000970323.1.94578 WP_000970323.1.94580 WP_000970323.1.94690 WP_000970323.1.94692 WP_000970323.1.94695 WP_000970323.1.94738 WP_000970323.1.94753 WP_000970323.1.94754 WP_000970323.1.948 WP_000970323.1.94801 WP_000970323.1.94806 WP_000970323.1.94808 WP_000970323.1.94822 WP_000970323.1.94880 WP_000970323.1.94889 WP_000970323.1.9489 WP_000970323.1.949 WP_000970323.1.94903 WP_000970323.1.9491 WP_000970323.1.94935 WP_000970323.1.94938 WP_000970323.1.94949 WP_000970323.1.94963 WP_000970323.1.94993 WP_000970323.1.95005 WP_000970323.1.95022 WP_000970323.1.95036 WP_000970323.1.95037 WP_000970323.1.9513 WP_000970323.1.95244 WP_000970323.1.95254 WP_000970323.1.95368 WP_000970323.1.95395 WP_000970323.1.95400 WP_000970323.1.95403 WP_000970323.1.95424 WP_000970323.1.95431 WP_000970323.1.95438 WP_000970323.1.95490 WP_000970323.1.95518 WP_000970323.1.95521 WP_000970323.1.95563 WP_000970323.1.9559 WP_000970323.1.95595 WP_000970323.1.95596 WP_000970323.1.95604 WP_000970323.1.95611 WP_000970323.1.95655 WP_000970323.1.95712 WP_000970323.1.95756 WP_000970323.1.95759 WP_000970323.1.95771 WP_000970323.1.95801 WP_000970323.1.95821 WP_000970323.1.95827 WP_000970323.1.95835 WP_000970323.1.95849 WP_000970323.1.95916 WP_000970323.1.95919 WP_000970323.1.95932 WP_000970323.1.960 WP_000970323.1.96015 WP_000970323.1.96032 WP_000970323.1.96114 WP_000970323.1.96128 WP_000970323.1.96215 WP_000970323.1.96229 WP_000970323.1.96247 WP_000970323.1.96278 WP_000970323.1.96293 WP_000970323.1.96299 WP_000970323.1.9631 WP_000970323.1.96339 WP_000970323.1.96341 WP_000970323.1.96394 WP_000970323.1.96420 WP_000970323.1.96457 WP_000970323.1.96484 WP_000970323.1.96494 WP_000970323.1.965 WP_000970323.1.96541 WP_000970323.1.96562 WP_000970323.1.9657 WP_000970323.1.96585 WP_000970323.1.96608 WP_000970323.1.96609 WP_000970323.1.9661 WP_000970323.1.96680 WP_000970323.1.96683 WP_000970323.1.96701 WP_000970323.1.96743 WP_000970323.1.96753 WP_000970323.1.96769 WP_000970323.1.96779 WP_000970323.1.96850 WP_000970323.1.9690 WP_000970323.1.96924 WP_000970323.1.96936 WP_000970323.1.96944 WP_000970323.1.96984 WP_000970323.1.96989 WP_000970323.1.97011 WP_000970323.1.97027 WP_000970323.1.97059 WP_000970323.1.9708 WP_000970323.1.97119 WP_000970323.1.97123 WP_000970323.1.97195 WP_000970323.1.97231 WP_000970323.1.97238 WP_000970323.1.97344 WP_000970323.1.97360 WP_000970323.1.97361 WP_000970323.1.97418 WP_000970323.1.97421 WP_000970323.1.97434 WP_000970323.1.97439 WP_000970323.1.9747 WP_000970323.1.97502 WP_000970323.1.97527 WP_000970323.1.97538 WP_000970323.1.97560 WP_000970323.1.97667 WP_000970323.1.97675 WP_000970323.1.97677 WP_000970323.1.97685 WP_000970323.1.97705 WP_000970323.1.97711 WP_000970323.1.97775 WP_000970323.1.97798 WP_000970323.1.97802 WP_000970323.1.97815 WP_000970323.1.97822 WP_000970323.1.97825 WP_000970323.1.97895 WP_000970323.1.97930 WP_000970323.1.97932 WP_000970323.1.97937 WP_000970323.1.97962 WP_000970323.1.97982 WP_000970323.1.97996 WP_000970323.1.98026 WP_000970323.1.9803 WP_000970323.1.98082 WP_000970323.1.9816 WP_000970323.1.9817 WP_000970323.1.98220 WP_000970323.1.98232 WP_000970323.1.98235 WP_000970323.1.98239 WP_000970323.1.98284 WP_000970323.1.98292 WP_000970323.1.98301 WP_000970323.1.98323 WP_000970323.1.98355 WP_000970323.1.98357 WP_000970323.1.98400 WP_000970323.1.98424 WP_000970323.1.98442 WP_000970323.1.98451 WP_000970323.1.98477 WP_000970323.1.98498 WP_000970323.1.98549 WP_000970323.1.98578 WP_000970323.1.9858 WP_000970323.1.98603 WP_000970323.1.98614 WP_000970323.1.98628 WP_000970323.1.9864 WP_000970323.1.98641 WP_000970323.1.98665 WP_000970323.1.98668 WP_000970323.1.98683 WP_000970323.1.98776 WP_000970323.1.98886 WP_000970323.1.98908 WP_000970323.1.98988 WP_000970323.1.99029 WP_000970323.1.99046 WP_000970323.1.99053 WP_000970323.1.9907 WP_000970323.1.99110 WP_000970323.1.99119 WP_000970323.1.99168 WP_000970323.1.99209 WP_000970323.1.99246 WP_000970323.1.99265 WP_000970323.1.99292 WP_000970323.1.99295 WP_000970323.1.99302 WP_000970323.1.99304 WP_000970323.1.99310 WP_000970323.1.99319 WP_000970323.1.99334 WP_000970323.1.99345 WP_000970323.1.99361 WP_000970323.1.99392 WP_000970323.1.99400 WP_000970323.1.99427 WP_000970323.1.99446 WP_000970323.1.99453 WP_000970323.1.99534 WP_000970323.1.99562 WP_000970323.1.99592 WP_000970323.1.99602 WP_000970323.1.99603 WP_000970323.1.99619 WP_000970323.1.99641 WP_000970323.1.99666 WP_000970323.1.99774 WP_000970323.1.99791 WP_000970323.1.99827 WP_000970323.1.99869 WP_000970323.1.99912 WP_000970323.1.99929 YP_006780481.1.12065 gi|407483332|ref|YP_006780481.1| gi|157160017|ref|YP_001457335.1| gi|238899775|ref|YP_002925571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]