SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 511995.CFPG_448 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  511995.CFPG_448
Domain Number 1 Region: 801-1178
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.5e-130
Family PFOR PP module 0.00000000539
Further Details:      
 
Domain Number 2 Region: 419-669
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.49e-76
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000246
Further Details:      
 
Domain Number 3 Region: 10-263
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.09e-74
Family PFOR Pyr module 0.0000000223
Further Details:      
 
Domain Number 4 Region: 264-416
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.36e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000143
Further Details:      
 
Domain Number 5 Region: 673-837
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.86e-17
Family Ferredoxin domains from multidomain proteins 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 511995.CFPG_448
Sequence length 1181
Comment (Candidatus Azobacteroides pseudotrichonymphae genomovar CFP2)
Sequence
MCKNSKNKGFLTCDGNQAAAHIAYMFSETASIYPITPSSTMAEYVDEWAASGRKNIFGET
VRVDEMQSEAGAAGAMHGALQAGALSTTFTASQGLLLMIPNMYKVAGELLPGVYHVSARA
LASHALSIFGDHQDVMAVRQTGCAMFVTGSVQEIMDLSAVAHLSAIKTRVPFVHFFDGFR
TSHEIQKIEQLNNEDLAPLIDQESLVAFRKRALNPDAPVARGMAQNSDIYFQAREACNKY
YNRVVDVVEDYTNRLSNLVGRKYGLFDYYGSQDAECIIVAMGSVTETIKETIDYLISKNK
KVGLVSVHLYRPFSVKHFLAVVPKSARCIAVLDRTKEPGSTGEPLYLDVKNCFYDSKEHP
LIVGGRYGLSSKDTTPACILAVYDNLSLFEPKNNFTVGITDDVTFTSLPQREELFLENGT
FEAKFYGLGADGTVGANKNSVKIIGDNTNKYCQAYFAYDSKKSGGFTSSHLRFGDKPIRS
AYLVNTPDFVACHIQAYLNLYDVTKGLKKHGTFLLNTIWNEKQVKENLPDNVKRYLSNNH
INFYIINATDIAHEIGLGNRTNTILQSAFFKITGIIPYNLAVEQMKRFIVKSYGKKGEDV
VNMNYAAVERGGDVLKIEVPIEWSDIQLKTEKIKDDIPNFVSKIAYSVNAQKGDDLPVSA
FVGYEDGTWEQGTAAYEKRGVGTHVPTWILDNCIQCNQCSYVCPHASIRPFILDESEQSE
APVDLDTLKAVGKKFEGMNFRMQVNVLDCLGCGNCVDVCPGNKNGKALQMSPIENEWNNQ
SNWDFCTEKVKTKQHLVDVSLNVRNSQFATPLFEFSGACSGCGETPYIKLISQLFGDHQM
IANATGCSSIYSGSAPSTPYTKNAKGHGPAWANSLFEDNAEYGFGMRIGTEKMRERVERL
MMQGLSCSRCSKEKKALFREWIDNRDDYAKTREIADSLVPMIRGSACCNICKQLTELTHY
FVKRSQWIIGGDGWGYDIGFGGLDHVIASGQNINILVLDTEVYSNTGGQSSKSTPAGAVA
KFAAAGKCIRKKDLGMMATTYGYVYVAQVAMGANQMQTLKAVCEAESYSGPSLIIAYSPC
ISHGLKKGMGKAQKEQKLAVECGYWHLWRFDPRLETEGRNPFQLDSKEPDWSKFQDFLKS
EIRFSSLMKQYPEKAQELFRITQANAKWRLDGYKRLVSQIY
Download sequence
Identical sequences B6YR89
511995.CFPG_448 WP_012573472.1.38342 gi|212550805|ref|YP_002309122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]