SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515621.CLJ_B0615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515621.CLJ_B0615
Domain Number 1 Region: 86-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000183
Family NfeD domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 515621.CLJ_B0615
Sequence length 146
Comment (Clostridium botulinum Ba4 657)
Sequence
MWSNFNIIVWIIIGTAALLLDLATSSFLFVWFTLGAIAALIVQILGYSMYIQIIVFTLIS
ILCMILGYPMVKKIIKKQENSILSIERNYVGEIFIADKDIKDEGVLKFQGVYWRVTNSGN
HIKKGDKVKINSVKGNKIFIKKVEEE
Download sequence
Identical sequences A0A0E1KVI0 A0A2I4P0B0
gi|237793866|ref|YP_002861418.1| 515621.CLJ_B0615 WP_003359818.1.101837 WP_003359818.1.20373 WP_003359818.1.28306 WP_003359818.1.34328 WP_003359818.1.49727 WP_003359818.1.57916 WP_003359818.1.95863 WP_003359818.1.97020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]