SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515621.CLJ_B2612 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  515621.CLJ_B2612
Domain Number - Region: 170-227
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00109
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 515621.CLJ_B2612
Sequence length 234
Comment (Clostridium botulinum Ba4 657)
Sequence
MEIKNHIMDQKEVYIKMGYSSDDAERAAIKDMGNPKATGKMLDSVHPPTIDWIQIIALIM
ITLTLQVLKILSELSGSNFSSIAPIDILRILGIFLSAYSLIWIGIEKYSGLPFFYGKSQH
GGSNANGVFICSLAIVMMSHSLLQTIILLLIFSPIIAIERSIIESKRIKKEQKFLWQQGI
AYEDFNYKGKAIFNDSQQKVYSRNEPIKKGDPIIITKIDGFNLVVEKQNLHNNN
Download sequence
Identical sequences gi|237795823|ref|YP_002863375.1| 515621.CLJ_B2612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]