SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515621.CLJ_B2987 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515621.CLJ_B2987
Domain Number 1 Region: 784-1191
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.47e-129
Family PFOR PP module 0.0000000031
Further Details:      
 
Domain Number 2 Region: 415-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.19e-89
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000444
Further Details:      
 
Domain Number 3 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.91e-78
Family PFOR Pyr module 0.0000000155
Further Details:      
 
Domain Number 4 Region: 258-412
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.14e-49
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000943
Further Details:      
 
Domain Number 5 Region: 665-829
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.81e-23
Family Ferredoxin domains from multidomain proteins 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 515621.CLJ_B2987
Sequence length 1192
Comment (Clostridium botulinum Ba4 657)
Sequence
MRRMKTMDGNTAAAYISYAFTDVAAIYPITPSSPMAEHVDEWVAQGKKNIFGQPVKVMEM
QSEAGAAGAVHGSLQAGALTTTYTASQGLLLMIPNMYKIAGELLPGVFHVSARALAANSL
NIFGDHQDVMAARQTGLALLAESSVQQVMDLSAVAHLSAIEGRVPFINFFDGFRTSHEIQ
KVEVLEYDELENLVDMDAVKAFRRRALNPDHPVIRGTAQNPDIYFQEREVSNNYYERLPE
IVEKYMGEISKLTGREYHLFNYYGAEDAERLIVAMGSVCDTVEEVVDYLMAKGEKVGLLT
VHLYRPFSLEHFFKYIPKTVKNIAVLDRTKEPGALAEPLYLDVKNAFYGKEWQPTIVGGR
YGLGSKETYPSHILSVFENLKKDEPKDGFTIGIVDDVTNTSLEEAEAINTTPVGTTACKF
WGLGSDGTVGANKSAIKIIGDHTDMYAQGYFAYDSKKSGGITISHLRFGKSPIQSPYLIN
QADFVACHNQSYVYKYNVLEGLKKGGRFLLNTIWTPEEVETHLPASMKKYIAENDIEFYT
LNAVKIAQEIGLGGRINMICQAAFFKIANIISVEDAVKYLKDAVVTNYGKKGQKIIDMNN
AAIDKGVNAIVKIEVPASWKDAKCEGACEAKENPEFIKNIVEPMNRQEGDKLPVSAFKGM
EDGTFPSGTAAYEKRGIAINVPEWQLDKCIQCNQCSYVCPHAVIRPVLLSDEEVKNAPEG
FESKPAAGAKGLNFTMAISPYDCTGCGNCADVCPAKEKALVMKPFDTQLEQAKNWEYAMK
VSPKANPMKKNSVKGSQFEQPLLEFSGACAGCGETPYAKLVTQLFGDRMMIANATGCSSI
WGASAPSTPYTTNHKGYGPAWANSLFEDNAEFGMGMYLGVKQIRDKVTEDVKAVLGFKSA
EELQSCAIGTEDCSEKDMTGTVISGELRAALEDWLNNKDLGENTRERADKVIELVGKEKG
SDKFLNEIYENKDFLVKRSHWIFGGDGWAYDIGYGGVDHVLASGEDVNILVFDTEVYSNT
GGQSSKATPTAAIAKFAASGKKTKKKDLGAMAMTYGYVYVAQIAMGADKNQTLKAIVEAE
AYPGPSLIIAYAPCINHGLKAGMGCSQLEEKKAVDCGYWGLYRFNPELKEAGKNPFSLDS
KEPTANFKDFLMGEVRYASLAKQFPEDAEALFAKTEQDAKERLENYKKLAEQ
Download sequence
Identical sequences 515621.CLJ_B2987 gi|237796195|ref|YP_002863747.1| WP_012720514.1.34328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]