SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 515635.Dtur_0260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515635.Dtur_0260
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-50
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 515635.Dtur_0260
Sequence length 190
Comment (Dictyoglomus turgidum DSM 6724)
Sequence
MKDMLEIRWHARAGQGAKTASYLLAETAMEAGKYIQAFPEYGPERTGAPMKAYTRISDKP
IRIHSQIYNPDVVVVLDKTLIGKVNILEGLPSDGILIVNTTQSPKEIREQLGISDRKIYT
VDATGIALETIGRPIPNTPMLGALIRVVPIISLDEVLNQFRKKFEGRFRPEVVEGNLQAI
KRAYEEVKGE
Download sequence
Identical sequences A0A2K2VBG7 B8E1R1
YP_002352200.1.71678 gi|217966694|ref|YP_002352200.1| 515635.Dtur_0260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]