SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 515635.Dtur_1417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515635.Dtur_1417
Domain Number 1 Region: 4-201
Classification Level Classification E-value
Superfamily Formyltransferase 2.09e-66
Family Formyltransferase 0.00000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 515635.Dtur_1417
Sequence length 205
Comment (Dictyoglomus turgidum DSM 6724)
Sequence
MERKRLGVLVSGRGSNLQALIDASKDENYPAEVVVVISNNPSAYAIERAKRENIPVFVIR
REDYKSKKEYEEKIKEVLQNFKVDLVVLAGYMKIVGKTLLEAFPNRIINIHPSLLPSFPG
LEAQRQAWEYGVKISGCTVHFVDEGIDSGPIIGQRAVPVYDDDTPATLAERILQEEHKLI
VESVKKILTEDFEIIGRRVVFKKRG
Download sequence
Identical sequences A0A2K2V8B5 B8E0V4
YP_002353305.1.71678 515635.Dtur_1417 gi|217967799|ref|YP_002353305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]