SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 517417.Cpar_0823 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  517417.Cpar_0823
Domain Number 1 Region: 18-201
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.74e-29
Family Clp protease, ClpP subunit 0.01
Further Details:      
 
Domain Number 2 Region: 370-437
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000051
Family NfeD domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 517417.Cpar_0823
Sequence length 443
Comment (Chlorobaculum parvum NCIB 8327)
Sequence
MIQAMISRFLKLGLMPVIAVMLCLAFTPLIGESAQIRSMTLSGSVNPGSAAWFLRELDEA
NREGDTLLLVELDTPGGLVASLRQMVQGVLASKVPVVVYVAPSGAQAASAGALLLLSSHV
AVMAPGTETGAAHPVGLGGQIDKESVMNTKIENDLAAFARSLAQKRGRSQQWAERAVRES
ISSTASEALEAGVIDTVASRREELLAFLDGRKVETAAGEVTIHTKGVPVLQSEPTFREKV
MMTIADPNIAAFLLLLGIAGLYFELTTPGAIFPGVAGVISLLLGAWAMQLLSVSVTGLLL
ILLAIIFFALEIFVTSGGVLAIAGLVALFIGSVMVFDAPEIGMTINWWFFLPLFLSFSAG
VLLLVFVVLRSTRRKVASGIEGLVGEAGVIEKGIAAGKSGKVFVHGELWDATAAVPIPAG
VQVTVTGIDGMRLNVKPNPTKEE
Download sequence
Identical sequences B3QMT6
gi|193212486|ref|YP_001998439.1| 517417.Cpar_0823 WP_012502072.1.59511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]