SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 517417.Cpar_1145 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  517417.Cpar_1145
Domain Number - Region: 33-96
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 
Domain Number - Region: 104-165
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Domain Number - Region: 178-235
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 517417.Cpar_1145
Sequence length 243
Comment (Chlorobaculum parvum NCIB 8327)
Sequence
MKKVLIVILLFFAAIVAIDKLLLPYYTEIGQQTVVPDVRNMTYAQASKALEKVGLKAMKS
YNVRYLPNVSPDQVIDQVPAPSSVVKPGRNVYLVLNRKDKPNYPMPDLSGRTEHEARQAL
ERIGMVISDVQTQAISEPDQDGRVLSQSVPPDVVLKSGSEVSFIVGKLEQEPTGTRRVIV
PDVLGMSVDQARGVLIRSGLSLGKVSYERSMLLVPDTVIGQKPSANEMVQYGQSVDMTVA
EAE
Download sequence
Identical sequences B3QNP8
517417.Cpar_1145 WP_012502384.1.59511 gi|193212798|ref|YP_001998751.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]