SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 517417.Cpar_1597 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  517417.Cpar_1597
Domain Number 1 Region: 83-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000484
Family NfeD domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 517417.Cpar_1597
Sequence length 149
Comment (Chlorobaculum parvum NCIB 8327)
Sequence
MFTPELIWFICGVVLALLEFAVPGVILVFFGVGAWITALTTYLGLTESTASQLLVFASTS
VILLFFLRSHIRSRFSGFVSDSQSPEQNLDEFTGKSVVVLEEITPMKPGKVEFKGAPWHA
ESNETFKSGEIGLIEKAEGLTLIIKKRGA
Download sequence
Identical sequences B3QPZ2
gi|193213242|ref|YP_001999195.1| 517417.Cpar_1597 WP_012502828.1.59511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]