SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 517418.Ctha_1816 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  517418.Ctha_1816
Domain Number 1 Region: 88-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000209
Family NfeD domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 517418.Ctha_1816
Sequence length 153
Comment (Chloroherpeton thalassium ATCC 35110)
Sequence
MESVLSISPAFIWFLVGVGFLAAEFGVPAFILLFFGAGAWIVSLLVLLLDIGLTAQVILF
ISSSLLLLSSLRKYSLKTFKGDVRNALDESFTDSKIGQIALVTKTIKPNFPGEVKVMGSY
WRAVSDTTLMEGQSALVVNIESEDGLTLKVIPT
Download sequence
Identical sequences B3QTS5
gi|193215521|ref|YP_001996720.1| WP_012500357.1.43748 517418.Ctha_1816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]