SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 518766.Rmar_0017 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  518766.Rmar_0017
Domain Number 1 Region: 24-191
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.33e-25
Family Crotonase-like 0.065
Further Details:      
 
Domain Number 2 Region: 366-433
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000301
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 518766.Rmar_0017
Sequence length 437
Comment (Rhodothermus marinus DSM 4252)
Sequence
MWPLLLWLMLLPMPAQTPAPVVYRLALEDEPITPATFRFIRRGLREATENGAVCLVVEMD
TPGGLVEATRDIVQLFLRSPIPVVVYVTPPGARAASAGVFITLAAHVAAMAPGTHIGAAH
PVQLGGGPAAPPDTARVDPMSEKILNDAVAWARALAQYRGRNADWAARAVSESQTLTARE
AVAQNVVDLLAPSLDSLLVLLDGRNVALDGQTVTLQTAGATVHMIERWWGERILAALSNP
NIAFLLLMLGFYGLLFELYTPGWGIPGTLGAIFLMLGFYGLSILPVNYVGLALLVLGLGM
LVAEAFVPSFGLLTVGGVVCLILGGLMLVESPMGFPKVSAALVVPVALATALIALFLLGN
ALRIQRRPARVGDETLIGQQAVAREDFTPEGDHFQGYVFVHGEWWRACSTAPVRAGQPVR
IERREGLRLWVSPIVST
Download sequence
Identical sequences D0MK13
gi|268315595|ref|YP_003289314.1| WP_012842538.1.83145 518766.Rmar_0017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]