SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 518766.Rmar_0391 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  518766.Rmar_0391
Domain Number 1 Region: 24-195
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.27e-28
Family Crotonase-like 0.066
Further Details:      
 
Domain Number 2 Region: 382-444
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000122
Family NfeD domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 518766.Rmar_0391
Sequence length 452
Comment (Rhodothermus marinus DSM 4252)
Sequence
MRRVFRRAFGLLALLSTTAIGRASEGPVYVVAVEGMVDNVLVQYIERAIHEAEAADAAAI
VFRIDTFGGLVAAADQIRQLILDTPLPTVAFIDRNAASAGALIAYACDRIVMAPGASMGA
ATVVEGTTGEAAPDKYQSYMRGLMRATAEANGRDPRIAEAMVDPDVAIEGLVPAGKVLTL
SAREALELGVADALAASVDEALQVLGYGPHPVVAFAQTGTERVLRVLASPVLQTLFLLMM
LGGLYFELQTPGVGVPGLIALAGALLFFAPNYLSGLVEFWEVVLFLVGVGLLLVELLVIP
GFGIAGIAGILFMLAGLLAALIGNVGLSFPSAREIGRAIATLTSTLILLGVGIAVLGRYL
PRTRRFQELVLGTGLSRTQGYTAAATEAQLTGKRGRAVTPLRPAGVVEIEGRRYDVVASG
QFVPAGTPVEVVRVQGSRIEVRPLSEAENQTS
Download sequence
Identical sequences D0ME71
518766.Rmar_0391 WP_012842907.1.83145 gi|268315964|ref|YP_003289683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]