SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 519441.Smon_1227 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  519441.Smon_1227
Domain Number 1 Region: 76-133
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000085
Family NfeD domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 519441.Smon_1227
Sequence length 133
Comment (Streptobacillus moniliformis DSM 12112)
Sequence
MENVYFWLGLFVIFIIIEIATYNLVTIWFAFSALIVSLISMLFKNTTLELFIFSALVAIF
LIYTRPILNKYFIQEKFNSDFKGNKISIVDIENDEYIVKFKGSKWTAISDEKFKVGDVVT
IEGFVGNKILIKK
Download sequence
Identical sequences D1AVC1
gi|269123981|ref|YP_003306558.1| WP_012859228.1.12341 WP_012859228.1.14448 WP_012859228.1.29480 WP_012859228.1.36664 WP_012859228.1.44000 WP_012859228.1.49772 WP_012859228.1.52871 WP_012859228.1.52956 WP_012859228.1.54298 WP_012859228.1.57556 WP_012859228.1.60729 WP_012859228.1.82586 WP_012859228.1.85210 WP_012859228.1.98389 WP_012859228.1.98509 519441.Smon_1227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]