SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 519442.Huta_0897 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  519442.Huta_0897
Domain Number 1 Region: 197-463
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.68e-67
Family PFOR Pyr module 0.05
Further Details:      
 
Domain Number 2 Region: 5-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-36
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0053
Further Details:      
 
Domain Number 3 Region: 472-580
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000328
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 519442.Huta_0897
Sequence length 590
Comment (Halorhabdus utahensis DSM 12940)
Sequence
MVNDLNWAIGGEAGDGIDSTGKIFARALSRAGRHVFTSKDFASRIRGGYTAYKVRTAVER
VESVVDRLDILIALTERTIDENLDELQEGSVIIYDGEQTTMADVEVPDGMIGLEVPLNSL
AEEAGGAIMRNVVALGAASEVADFPVEYLDEALVKRFGEKGEAIIANNREAARLGRDYVR
EETDCSHEFALETTDEDYVLLNGDEAIGMAAIAAGCRFYAGYPITPATDVMEYLTGRIEA
FGGAVVQAEDELSAINMALGAARAGARAMTATSGPGIDLMNETFGLVATSETPLVIANVM
RSGPSTGMPTKQEQGDLNAMLYGGHGEIPRFVLAPTTIGECFDRTVEAFNLAEKYQIPVY
LTADLALAVTEQTYSPERFDMEGVEIDRGKVVDADEVGEWLDEKGRFKAHAATEDGVSPR
ALPGTPDAAHMTTGLEHDELGRRTEEEDVRVEQVQKRQRKVDTARDREAFDYREFGDSDA
ETLVISWGSNEGAMREALGMLDDRGIDVRFLSVPYIYPRPDLTDEVEAAEDVIVVECNAT
GQFADLIEHDTLSRVQRVTKYTGVRFKADELADEIEGAIAGERAPQEVKR
Download sequence
Identical sequences C7NUR7
gi|257051980|ref|YP_003129813.1| 519442.Huta_0897 WP_015788657.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]