SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 521006.NGK_1025 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521006.NGK_1025
Domain Number 1 Region: 71-132
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000798
Family NfeD domain-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521006.NGK_1025
Sequence length 135
Comment (Neisseria gonorrhoeae NCCP11945)
Sequence
MTVWFVAAVAVLIIELLTGTVYLLVVSAALAGSGIAYGLTGSTPAAVLTAALLSALGIWF
VHAKTAVGKVETDSYQDLDTGKYAEILRYTGGNRYEVFYRGTHWQAQNTGQEVFEPGTRA
LIVRKEGNLLIIANP
Download sequence
Identical sequences A0A1D3H484 B4RLL5 D6H825 Q5F8I6
gi|194098588|ref|YP_002001650.1| GO.2795 WP_003704054.1.100340 WP_003704054.1.100478 WP_003704054.1.100556 WP_003704054.1.100674 WP_003704054.1.100774 WP_003704054.1.101026 WP_003704054.1.10157 WP_003704054.1.101626 WP_003704054.1.101960 WP_003704054.1.102080 WP_003704054.1.10554 WP_003704054.1.10719 WP_003704054.1.11196 WP_003704054.1.11215 WP_003704054.1.11432 WP_003704054.1.11593 WP_003704054.1.11598 WP_003704054.1.11605 WP_003704054.1.11648 WP_003704054.1.11780 WP_003704054.1.118 WP_003704054.1.12269 WP_003704054.1.12401 WP_003704054.1.12408 WP_003704054.1.12969 WP_003704054.1.13128 WP_003704054.1.1360 WP_003704054.1.13808 WP_003704054.1.13996 WP_003704054.1.14055 WP_003704054.1.14086 WP_003704054.1.14503 WP_003704054.1.14572 WP_003704054.1.14702 WP_003704054.1.14736 WP_003704054.1.14867 WP_003704054.1.15092 WP_003704054.1.1519 WP_003704054.1.15404 WP_003704054.1.15472 WP_003704054.1.15676 WP_003704054.1.15794 WP_003704054.1.15929 WP_003704054.1.16216 WP_003704054.1.16513 WP_003704054.1.16720 WP_003704054.1.16907 WP_003704054.1.17281 WP_003704054.1.17358 WP_003704054.1.17452 WP_003704054.1.17491 WP_003704054.1.17557 WP_003704054.1.17669 WP_003704054.1.17997 WP_003704054.1.18004 WP_003704054.1.18213 WP_003704054.1.18612 WP_003704054.1.18855 WP_003704054.1.19099 WP_003704054.1.19309 WP_003704054.1.19316 WP_003704054.1.19563 WP_003704054.1.19598 WP_003704054.1.19652 WP_003704054.1.19712 WP_003704054.1.20303 WP_003704054.1.2032 WP_003704054.1.21065 WP_003704054.1.21221 WP_003704054.1.21563 WP_003704054.1.21622 WP_003704054.1.21626 WP_003704054.1.21844 WP_003704054.1.22742 WP_003704054.1.22912 WP_003704054.1.23186 WP_003704054.1.23479 WP_003704054.1.23608 WP_003704054.1.23780 WP_003704054.1.24180 WP_003704054.1.24360 WP_003704054.1.24534 WP_003704054.1.2468 WP_003704054.1.24807 WP_003704054.1.2484 WP_003704054.1.24967 WP_003704054.1.25223 WP_003704054.1.25464 WP_003704054.1.25530 WP_003704054.1.25790 WP_003704054.1.25859 WP_003704054.1.25919 WP_003704054.1.25936 WP_003704054.1.25989 WP_003704054.1.26035 WP_003704054.1.26393 WP_003704054.1.26568 WP_003704054.1.2711 WP_003704054.1.27438 WP_003704054.1.28332 WP_003704054.1.28539 WP_003704054.1.28797 WP_003704054.1.29027 WP_003704054.1.29241 WP_003704054.1.29678 WP_003704054.1.29690 WP_003704054.1.30002 WP_003704054.1.30685 WP_003704054.1.30922 WP_003704054.1.31843 WP_003704054.1.32069 WP_003704054.1.32564 WP_003704054.1.32778 WP_003704054.1.33058 WP_003704054.1.33605 WP_003704054.1.33857 WP_003704054.1.33955 WP_003704054.1.34186 WP_003704054.1.34493 WP_003704054.1.35650 WP_003704054.1.35766 WP_003704054.1.35838 WP_003704054.1.359 WP_003704054.1.35998 WP_003704054.1.36743 WP_003704054.1.36815 WP_003704054.1.37162 WP_003704054.1.37499 WP_003704054.1.37682 WP_003704054.1.37920 WP_003704054.1.37958 WP_003704054.1.38116 WP_003704054.1.3854 WP_003704054.1.38592 WP_003704054.1.3868 WP_003704054.1.38959 WP_003704054.1.39024 WP_003704054.1.39077 WP_003704054.1.393 WP_003704054.1.39303 WP_003704054.1.39487 WP_003704054.1.3952 WP_003704054.1.39627 WP_003704054.1.39755 WP_003704054.1.3985 WP_003704054.1.40035 WP_003704054.1.40104 WP_003704054.1.40772 WP_003704054.1.41577 WP_003704054.1.42224 WP_003704054.1.42665 WP_003704054.1.42894 WP_003704054.1.42901 WP_003704054.1.43153 WP_003704054.1.43189 WP_003704054.1.43348 WP_003704054.1.4339 WP_003704054.1.43541 WP_003704054.1.43586 WP_003704054.1.43854 WP_003704054.1.44194 WP_003704054.1.4448 WP_003704054.1.44621 WP_003704054.1.4497 WP_003704054.1.45509 WP_003704054.1.45863 WP_003704054.1.46190 WP_003704054.1.46428 WP_003704054.1.46903 WP_003704054.1.47393 WP_003704054.1.47474 WP_003704054.1.47826 WP_003704054.1.47844 WP_003704054.1.48058 WP_003704054.1.48286 WP_003704054.1.48369 WP_003704054.1.48644 WP_003704054.1.49022 WP_003704054.1.49068 WP_003704054.1.49284 WP_003704054.1.49608 WP_003704054.1.49665 WP_003704054.1.49694 WP_003704054.1.50069 WP_003704054.1.50074 WP_003704054.1.50197 WP_003704054.1.50678 WP_003704054.1.50912 WP_003704054.1.51699 WP_003704054.1.52063 WP_003704054.1.52094 WP_003704054.1.52104 WP_003704054.1.52237 WP_003704054.1.52948 WP_003704054.1.53130 WP_003704054.1.53298 WP_003704054.1.53438 WP_003704054.1.536 WP_003704054.1.53779 WP_003704054.1.53832 WP_003704054.1.53860 WP_003704054.1.54122 WP_003704054.1.54174 WP_003704054.1.54378 WP_003704054.1.54389 WP_003704054.1.54642 WP_003704054.1.54659 WP_003704054.1.55159 WP_003704054.1.55406 WP_003704054.1.5594 WP_003704054.1.55987 WP_003704054.1.56090 WP_003704054.1.56109 WP_003704054.1.56168 WP_003704054.1.56256 WP_003704054.1.56686 WP_003704054.1.56813 WP_003704054.1.57030 WP_003704054.1.57062 WP_003704054.1.57372 WP_003704054.1.57375 WP_003704054.1.57388 WP_003704054.1.57697 WP_003704054.1.57901 WP_003704054.1.57984 WP_003704054.1.58235 WP_003704054.1.58285 WP_003704054.1.58880 WP_003704054.1.58971 WP_003704054.1.59161 WP_003704054.1.59728 WP_003704054.1.59792 WP_003704054.1.60234 WP_003704054.1.60565 WP_003704054.1.6084 WP_003704054.1.61510 WP_003704054.1.61526 WP_003704054.1.61701 WP_003704054.1.62467 WP_003704054.1.62499 WP_003704054.1.64272 WP_003704054.1.64284 WP_003704054.1.64344 WP_003704054.1.64652 WP_003704054.1.65089 WP_003704054.1.65891 WP_003704054.1.66113 WP_003704054.1.66283 WP_003704054.1.66353 WP_003704054.1.66920 WP_003704054.1.66927 WP_003704054.1.67738 WP_003704054.1.68023 WP_003704054.1.68047 WP_003704054.1.68082 WP_003704054.1.68298 WP_003704054.1.68445 WP_003704054.1.68634 WP_003704054.1.68663 WP_003704054.1.68720 WP_003704054.1.68771 WP_003704054.1.68907 WP_003704054.1.68996 WP_003704054.1.69030 WP_003704054.1.69067 WP_003704054.1.69334 WP_003704054.1.69555 WP_003704054.1.70265 WP_003704054.1.70295 WP_003704054.1.70552 WP_003704054.1.70616 WP_003704054.1.71019 WP_003704054.1.71233 WP_003704054.1.71321 WP_003704054.1.71411 WP_003704054.1.71646 WP_003704054.1.71766 WP_003704054.1.72029 WP_003704054.1.72225 WP_003704054.1.72384 WP_003704054.1.72495 WP_003704054.1.72726 WP_003704054.1.72840 WP_003704054.1.72928 WP_003704054.1.73313 WP_003704054.1.73620 WP_003704054.1.73930 WP_003704054.1.74343 WP_003704054.1.74542 WP_003704054.1.74619 WP_003704054.1.74643 WP_003704054.1.74664 WP_003704054.1.75113 WP_003704054.1.7522 WP_003704054.1.75279 WP_003704054.1.756 WP_003704054.1.75674 WP_003704054.1.7615 WP_003704054.1.77089 WP_003704054.1.77864 WP_003704054.1.7798 WP_003704054.1.78114 WP_003704054.1.78239 WP_003704054.1.78247 WP_003704054.1.78732 WP_003704054.1.78753 WP_003704054.1.78972 WP_003704054.1.79000 WP_003704054.1.79980 WP_003704054.1.80173 WP_003704054.1.80312 WP_003704054.1.81926 WP_003704054.1.82336 WP_003704054.1.82560 WP_003704054.1.827 WP_003704054.1.83631 WP_003704054.1.84030 WP_003704054.1.84035 WP_003704054.1.8435 WP_003704054.1.84421 WP_003704054.1.84853 WP_003704054.1.84886 WP_003704054.1.84927 WP_003704054.1.85285 WP_003704054.1.85288 WP_003704054.1.85439 WP_003704054.1.8553 WP_003704054.1.85530 WP_003704054.1.85632 WP_003704054.1.85925 WP_003704054.1.85988 WP_003704054.1.86402 WP_003704054.1.86819 WP_003704054.1.86978 WP_003704054.1.87176 WP_003704054.1.87542 WP_003704054.1.87729 WP_003704054.1.88158 WP_003704054.1.88213 WP_003704054.1.8824 WP_003704054.1.89770 WP_003704054.1.90025 WP_003704054.1.90351 WP_003704054.1.9054 WP_003704054.1.90659 WP_003704054.1.91401 WP_003704054.1.91463 WP_003704054.1.91535 WP_003704054.1.91671 WP_003704054.1.91698 WP_003704054.1.91889 WP_003704054.1.92250 WP_003704054.1.92483 WP_003704054.1.92635 WP_003704054.1.92766 WP_003704054.1.93389 WP_003704054.1.93791 WP_003704054.1.93847 WP_003704054.1.94006 WP_003704054.1.94038 WP_003704054.1.94083 WP_003704054.1.94131 WP_003704054.1.94164 WP_003704054.1.94609 WP_003704054.1.94665 WP_003704054.1.9501 WP_003704054.1.95316 WP_003704054.1.95636 WP_003704054.1.95791 WP_003704054.1.95891 WP_003704054.1.9598 WP_003704054.1.96795 WP_003704054.1.96806 WP_003704054.1.96988 WP_003704054.1.97104 WP_003704054.1.97177 WP_003704054.1.97332 WP_003704054.1.97455 WP_003704054.1.9754 WP_003704054.1.98029 WP_003704054.1.98365 WP_003704054.1.98671 WP_003704054.1.98909 WP_003704054.1.99118 WP_003704054.1.99147 WP_003704054.1.99189 WP_003704054.1.99247 WP_003704054.1.99374 WP_003704054.1.99376 WP_003704054.1.99719 WP_003704054.1.99822 WP_003704054.1.99840 YP_207913.1.29278 gi|385335714|ref|YP_005889661.1| gi|59801201|ref|YP_207913.1| 242231.NGO0787 521006.NGK_1025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]