SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 521011.Mpal_0183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521011.Mpal_0183
Domain Number 1 Region: 8-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000041
Family ScpB/YpuH-like 0.055
Further Details:      
 
Weak hits

Sequence:  521011.Mpal_0183
Domain Number - Region: 106-130
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0549
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521011.Mpal_0183
Sequence length 269
Comment (Candidatus Methanosphaerula palustris E1 9c)
Sequence
MTEPDNVRSTTILRSKREVTRFQILVEVAEHQPAVRQLEIAEKLGVTPQAVSEYIRELVE
DGMVSAYGRGRYEVTRTGIEWVLNNAEELETYARHIRRDLIQQVSVWTAIADANLHKGEV
VGVYMKDGWLYAGRGDQSASGQVIEETVTGEDVGVTRLNGIIDHHEGVIHVCKVPRIQRG
GSRMVNPDALQEVLEGVKVVAAVGLEAYIALKTRGRTADMFFGAREGVIEAAFHGLDCAM
FIVDEEFTEFLKRLEDVGLTYRIHDLIRA
Download sequence
Identical sequences B8GIZ9
WP_012616891.1.75456 gi|219850863|ref|YP_002465295.1| 521011.Mpal_0183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]