SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 521011.Mpal_2718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521011.Mpal_2718
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.24e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 521011.Mpal_2718
Sequence length 175
Comment (Candidatus Methanosphaerula palustris E1 9c)
Sequence
MFEIRIHSRGGQGGVTAAKLLAQAAFNDHKYATAAPFYGAERRGAPVVSFVRISDEPIKV
YSQIRSPDLVVVLDSSVMDVIDVLNGIKPDGTVLINSAHAVTMDGHTTHHVDLTGIALSL
GLVVAGSPILNTPVLGALAKLGIVSQESARKAIRGTFTDERNVKAAEQAYAEVTV
Download sequence
Identical sequences B8GFU9
gi|219853273|ref|YP_002467705.1| WP_012619301.1.75456 521011.Mpal_2718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]