SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 521045.Kole_0310 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521045.Kole_0310
Domain Number 1 Region: 76-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000157
Family NfeD domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 521045.Kole_0310
Sequence length 149
Comment (Kosmotoga olearia TBF 19 5 1)
Sequence
MEYIGWMILGVALLVVEIITPIFFFLWFAIGSFIAGIASFFGLSFSWQLSLFSAVSVVLV
ILTRPIAKKLTGESPRKIYIDEIKGSIGNVVEEINNKKRTGVVRAAGENWKAVSIDDDII
GVGEKVIVERLEGTIVYVRKFKNENAQDE
Download sequence
Identical sequences C5CD91
WP_012744822.1.19116 WP_012744822.1.82044 gi|239616717|ref|YP_002940039.1| 521045.Kole_0310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]