SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 521045.Kole_2137 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521045.Kole_2137
Domain Number 1 Region: 184-438
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.63e-59
Family PFOR Pyr module 0.066
Further Details:      
 
Domain Number 2 Region: 6-209
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.75e-30
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 454-547
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000479
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521045.Kole_2137
Sequence length 551
Comment (Kosmotoga olearia TBF 19 5 1)
Sequence
MKELVIAISGEAGQGIQTAGNLAAKALFRAGYNVFTDKSYHSRIRGGEYIYRIRVSEYPV
YAMREEVDLVASLSSVTTNTLERYIHSNTVVVADKEDVGHKFEPIRIKFKERAKGAGNPR
TLNTVIVGAILKALDVPVEIPIQLITDYFTSSEQLLESNIKALKNGYEISLDLSFKKIPK
NRENERLLLNGTEGTGLGAIAAGCRFISAYPMTPGTGVMLFLAKRAEKYSIVVEQAEDEI
AAINMAIGASFAGVRSMVTTSGGGFALMQEGVSLAGMTETPVVIVDAQRPAPATGLPTRT
AQEDLYFVLKSGHGEFPRYICAPRTSKEAFELTEKAFYLADKYQIPAFVLLSQQLVDSQA
TIEPPVHRSEYSKRFLIKSDEGLEYKRYQLTKNGVSPRAIPGGDAIVRADSDEHDEYGFI
TEDLEIRAGMVEKRNKKLESLQKEIASPLTYNLEADTILVGWGDSWGAIDEFARKRNLGY
VHYNELYPLNLNIFDQLKNKRLITVEGNYTGQFAELLASKLYRKVEHIGRYDGRPITANW
LDKKLEEVGKI
Download sequence
Identical sequences C5CIB2
gi|239618496|ref|YP_002941818.1| WP_015869455.1.82044 521045.Kole_2137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]