SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521095.Apar_0713 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521095.Apar_0713
Domain Number 1 Region: 265-350
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000113
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0053
Further Details:      
 
Domain Number 2 Region: 34-208
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 0.00000000133
Family Dihydropteroate synthetase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 521095.Apar_0713
Sequence length 357
Comment (Atopobium parvulum DSM 20469)
Sequence
MSELARTKTHPVMVGPVQVGGGAPVSVQSMCTTKTDDADATLHQIKKLAEAGCEIIRVAI
PDAKALNGFEEICKYSPLPVVADIHFDYKLALEAAKRGAAALRINPGNIGSMERVDAVID
AAKEAHIPIRIGVNAGSLAKEFDTRQDMTLVEKLVASSKSFVEHFSSRGFDNIVLSAKAH
DVPTTLAVYRALSKELPQIPLHVGVTEAGALRQGTVKNSAAVGILLESGIGDTMRLSLTA
DPIEEVHVAWELLAALGMRRIKPELVSCPTCGRCGVDMIPIAEEVTKRLDGVRAPISVAV
MGCVVNGPGEAKGVDLGVACGKGQAVLFENGNPIRKVPEDKIVDELFTEIENRFGKK
Download sequence
Identical sequences C8WAK4
gi|257784516|ref|YP_003179733.1| 521095.Apar_0713 WP_012808799.1.33702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]