SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 521095.Apar_1328 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521095.Apar_1328
Domain Number 1 Region: 799-1175
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.28e-116
Family PFOR PP module 0.00000000713
Further Details:      
 
Domain Number 2 Region: 417-667
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-74
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000423
Further Details:      
 
Domain Number 3 Region: 4-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.96e-72
Family PFOR Pyr module 0.0000000415
Further Details:      
 
Domain Number 4 Region: 259-409
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.71e-49
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000128
Further Details:      
 
Domain Number 5 Region: 676-836
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.91e-21
Family Ferredoxin domains from multidomain proteins 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 521095.Apar_1328
Sequence length 1184
Comment (Atopobium parvulum DSM 20469)
Sequence
MARKFKSMDGNNAAAYVSYAFTEVAGIYPITPSSPMADYVDQWSAQGVKNIFGTTVKVVE
MQSEAGAAGAVHGSLGSGALTTTYTASQGLLLMLPNMYKIAGEQLPGVFHVSARTVATHA
LNIFGDHSDVMATRQTGFALLAEGNVQEVMDLAPVAHLAAIKGKVPFVNFFDGFRTSHEI
QKVAVWDYADLAEMCDMDAVQAFRDHALNPEHPASRGSHENGDIFFQHREACNEVYNQLP
AVVEDYMNKINAKLGTDYGLFNYYGAEDADRVVICMGSFCDTLEEVIDYLNAHGEKVGLV
KVRLYRPFSVKHFVDVLPESVKKIAVLDRTKEPGSVGEPLYEDVVSSLYEAGRTGIKVVG
GRYGLGSKDTPPSSAFAIFEELKKDNPQREFTIGIVDDVTNLSLPEDPEAPNTAAEGTIE
CKFWGIGGDGTVGANKNSIKIIGDHTDKYVQAYFQYDSKKTGGITISHLRFGDHKIRSPY
YVTKADFVACHVPAYIIKGYKMVRDVKPGGTFLVNCQWDAEEFAHHLPAEAKRYIAKNNI
NVYLINAIDLAKEIGMGKRTNTILQSAFFALAKVLPEADALQYMKDAATHSYLKKGQNVV
DMNHKAIDAGATAFTKIEIPADWASAEDAPSTITLEGREALLKQVRDIMTPVSRMEGDAL
PVSAFKNHVDGQFELGAAAYEKRGIAVVVPEWNVEKCIQCNQCAYVCPHAVIRPFVLTDE
EVAAAPAQSQFKDAVGPKAKGYKFEIAISQLDCTGCSNCVYICPADALTMKPIEEQESKQ
EIFDYAVNHVSEKTELVANNVKGSQFKKPLLEFSGSCAGCAETSYGRLVTQLFGDRMYIS
NATGCSSIWGNPASCSPFTTDANGHGPAWNNSLFEDNAEHGMGLMLGHQAQQKRLLELAQ
QLVDEDGASQDLKDAAKAWIESVNDAALSKEASKTFVVELAKSDLATAKEILANKSFLTK
KSFWIFGGDGWAYDIGFGGLDHVLASGEDINVFVFDTEVYSNTGGQSSKASRLGQVAQFA
AAGKDIKQKNLAEIAMTYGYVYVAQVSMGANLQQTLKAIAEAEAYPGPSLIIGYSPCEMH
SIKGGMAHAQEEMKKAVDTGYWNLYRFNPSAPAGKKFTLDSKAPKGGYQEFLMNEARYSR
LTREFPEHAEKLFKENEEAAMARYDHLVRLSELYAAEKKEQPEE
Download sequence
Identical sequences C8W8G1
WP_012809408.1.33702 521095.Apar_1328 gi|257785126|ref|YP_003180343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]