SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 521098.Aaci_1286 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  521098.Aaci_1286
Domain Number - Region: 2-55
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0222
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521098.Aaci_1286
Sequence length 125
Comment (Alicyclobacillus acidocaldarius DSM 446)
Sequence
MYWLPVLGLAVGIGLGLVTNVVIPVAFTSYLSIAILAALDTVVGGIRASLDKTFDSAVFL
SGFFTNTLVAALLAYIGNQLGVDLYLAAVVAFGVRLFQNIAVIRRHVFTLIRQRRVARRM
ASTKD
Download sequence
Identical sequences B7DRR0 C8WW42
gi|258511269|ref|YP_003184703.1| 521098.Aaci_1286 WP_008339613.1.29831 WP_008339613.1.49045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]