SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 521460.Athe_1009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521460.Athe_1009
Domain Number 1 Region: 2-176
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 521460.Athe_1009
Sequence length 186
Comment (Anaerocellum thermophilum DSM 6725)
Sequence
MNDIIIAGIGGQGNILLSRVICQLFMNRGFDVKSAENIGMSQRGGSVVSYIRVGDEVGPI
VPDGKANILIGLEMSEAARNVNKINKNSLVVLNNRFVRPKNSDLKKQQILNLIESNIPKF
YILNAFDIALELDMPKAENITMLTLICKKEIFPFSKEEIMTALKLVLSPQMYEMNKILVE
KIYEKY
Download sequence
Identical sequences A0A2G6VJ13 B9MR06
521460.Athe_1009 gi|222529001|ref|YP_002572883.1| WP_015907524.1.1144 WP_015907524.1.22435 WP_015907524.1.28668 WP_015907524.1.33084 WP_015907524.1.45436 WP_015907524.1.58293 WP_015907524.1.61668 WP_015907524.1.71443 WP_015907524.1.77617 WP_015907524.1.9959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]