SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521460.Athe_1424 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521460.Athe_1424
Domain Number 1 Region: 79-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.16e-96
Family RecA protein-like (ATPase-domain) 0.00000000299
Further Details:      
 
Domain Number 2 Region: 348-462
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 6.02e-55
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000628
Further Details:      
 
Domain Number 3 Region: 3-77
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 1.96e-26
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 521460.Athe_1424
Sequence length 467
Comment (Anaerocellum thermophilum DSM 6725)
Sequence
MEQNVGYVVQIIGPVIDIRFESENLPAINNAIEIHFDGKKLVAEVAQHLGNDTVRCVALG
STDGLRRGVKAIDTGGPIKVPVGRGTLGRIFNVLGEPIDNKGEVVASDYWPIHRSAPSFE
EQVPAVEIFETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGFSIFT
GVGERTREGNDLWLDMNESGVIEKTVLVFGQMNEPPGARMRVALTGLTMAEYFRDVEGQD
VLLFIDNIFRFIQAGSEVSALLGRIPSAVGYQPTLANEVGALQERITSTKKGSITSVQAI
YVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPRIVGEEHYYV
ARTVQQILQRYKELQDIIAILGMDELSEEDKLIVYRARKIQRFLSQPFFVAEAFTGRPGR
YVKLKDTIRGFKEIIEGKMDHIPEQYFYMVGTIDEVYENYEKDMKGK
Download sequence
Identical sequences A0A2G6U959 B9MS68
WP_015907887.1.1144 WP_015907887.1.22435 WP_015907887.1.28668 WP_015907887.1.33084 WP_015907887.1.45436 WP_015907887.1.58293 WP_015907887.1.61668 WP_015907887.1.71443 WP_015907887.1.77617 WP_015907887.1.9959 gi|222529413|ref|YP_002573295.1| 521460.Athe_1424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]