SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 522306.CAP2UW1_1831 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  522306.CAP2UW1_1831
Domain Number 1 Region: 9-203
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.18e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 522306.CAP2UW1_1831
Sequence length 211
Comment (Candidatus Accumulibacter phosphatis clade IIA UW 1)
Sequence
MSEAGRFDTTNILVVGTGGQGVMTATEILAEAAIALGHDAKKTEVAGMAQRGGVVSSHLR
FGAKVLSPQITPGSADVLLGFEAAEAMRWRHMLRAGGLVLMNTGRLVPPVVELGLYDYPD
DPVGQMRAAGTRVFSFDASAIAQELGDIRLGNTVMLGAIADHLPFPAEVLERCILKRFAR
KKAEVIELNRQAFAAGRAAAEQAARTAAEAG
Download sequence
Identical sequences C7RV53
2000457600 gi|257093420|ref|YP_003167061.1| WP_015766333.1.47741 2001099870 2000169120 522306.CAP2UW1_1831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]