SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 523791.Kkor_2297 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  523791.Kkor_2297
Domain Number - Region: 109-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000981
Family NfeD domain-like 0.01
Further Details:      
 
Domain Number - Region: 50-119
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 0.0118
Family Retrovirus capsid protein, N-terminal core domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 523791.Kkor_2297
Sequence length 154
Comment (Kangiella koreensis DSM 16069)
Sequence
MEIFLQVEYWHWLVFGLVLLILEIFAPGAILLWFGLGALAVGVFQLLMPGLMPPEIQWLV
FSVLSVASLILWKQYAQKHKLDQDDDSGSLNQRSKSLIGREFNLSNAIVNGVGKVRVGDS
YWRVEGPDLPEGQKVKVVGFEGATLKVIAVDSEA
Download sequence
Identical sequences C7R8E1
gi|256823511|ref|YP_003147474.1| WP_015781311.1.96353 523791.Kkor_2297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]