SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 523794.Lebu_0564 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  523794.Lebu_0564
Domain Number 1 Region: 98-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000085
Family NfeD domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 523794.Lebu_0564
Sequence length 142
Comment (Leptotrichia buccalis DSM 1135)
Sequence
MGALFWAILSGTFAVLEIIIPGLVTIWFALSALIVMFFSNFSNDSTIEFFVFAVLSLIFL
IFTRPVLRRYIDMQKKNGFNSSMKGADVKVEKIVDARRIEKEYEVKFKGSIWTGISEEIF
SAGEIVKIKEFRGNKIILERKY
Download sequence
Identical sequences C7N8J3
gi|257125351|ref|YP_003163465.1| 523794.Lebu_0564 WP_012806656.1.20655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]