SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 523794.Lebu_0932 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  523794.Lebu_0932
Domain Number - Region: 10-60
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0799
Family Group I mobile intron endonuclease 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 523794.Lebu_0932
Sequence length 66
Comment (Leptotrichia buccalis DSM 1135)
Sequence
MKILTKEEADTMVCDGAKLNLSSFSYNLKIYYENKKIKNVYEKTILKMDNDLELTEKVEV
KGKKRE
Download sequence
Identical sequences C7N9K4
523794.Lebu_0932 gi|257125712|ref|YP_003163826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]