SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 523850.TON_0585 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  523850.TON_0585
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.02e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 523850.TON_0585
Sequence length 170
Comment (Thermococcus onnurineus NA1)
Sequence
MQIRFAGIGGQGVVLAGVILGEAAAIEGLNVLQTQDYSSASRGGHSIADVIISKEPIYDV
IVTKADVLVALHRLGYDTVKEELKEDGILIIDTDLVKPDKDYIGAPFTRLAEENTGLALT
VNMVALGYLVAKTGVVKKENVEEAIKRRVPKGTEEINIKAFNAGYEEGLK
Download sequence
Identical sequences B6YUN6
523850.TON_0585 WP_012571544.1.24713 gi|212223733|ref|YP_002306969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]