SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 523850.TON_1057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  523850.TON_1057
Domain Number 1 Region: 6-190
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.59e-31
Family Clp protease, ClpP subunit 0.007
Further Details:      
 
Domain Number 2 Region: 371-438
Classification Level Classification E-value
Superfamily NfeD domain-like 2.88e-16
Family NfeD domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 523850.TON_1057
Sequence length 441
Comment (Thermococcus onnurineus NA1)
Sequence
MKLKIVLIVLILFVTFFPSAHAQGNTVYVAKIDGMITGYTVDQFDRYISEAEKANASAII
IELNTPGGRADAMQEIVMRIQNAKVPVIIYVYPSGGMAASAGTYIALGSHLIAMAPGTVI
GACRPILGYGANGSIVEAPAKIVNFYITYLRELAEMSGRNATLAEQFITEDRSVTSQEAL
EYGVIEVVATDVNDLLQKTDGMETKIPVKGKGKVVLNFKDARVVYLKPSFKDTVVKYITD
PTIAYILLNLGFIGIIFGFLTPGWHVPETAGAIMLVLGLIGLGYFGYSSAGLLLIVLAMI
FFIAEALTPTFGLFTVAGTITFILGGIMLFGSGGGEYLVSGAIYEMLRIVIIVMAILMGL
FFAFGAAAAVKAHRRRPESGKEELIGAKGKVIQELNPEGMIRVHGELWKALSKDGSRIPA
GEKVRIVEIKGLTLIVEKEGD
Download sequence
Identical sequences B6YWT2
523850.TON_1057 gi|212224206|ref|YP_002307442.1| WP_012572017.1.24713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]