SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 523850.TON_1224 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  523850.TON_1224
Domain Number 1 Region: 61-124
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000127
Family NfeD domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 523850.TON_1224
Sequence length 127
Comment (Thermococcus onnurineus NA1)
Sequence
MKKGNILKLLALMADELIVAVLLLIVLPAMGINVPTRGVLVILGVLLIKDIVIAPFLLNT
FDRKVEVGVEVLIGRTAVVVEDLTSEGLVKLEGGLWKAECINGTARRGEEVKVVAVEGTK
VLVECPE
Download sequence
Identical sequences B6YX99
WP_012572184.1.24713 gi|212224373|ref|YP_002307609.1| 523850.TON_1224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]