SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525146.Ddes_0052 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525146.Ddes_0052
Domain Number 1 Region: 94-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000994
Family NfeD domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 525146.Ddes_0052
Sequence length 158
Comment (Desulfovibrio desulfuricans ATCC 27774)
Sequence
MNAPLLWFILGAAFFVAELMTPAMVLLFFGVGAWVAALTALMGLGLAWQLITFICLSLLT
LLFLRRRLRAVFGGRAHRVPAGNCNSHGEESCSPHPLTGRQGVVSKAVHPGKIGEVSIDG
SFWRATAHEKLAEGSPVRVQGADPGDALVLHVSPATKS
Download sequence
Identical sequences A0A1K1MZ64 B8J1X7
525146.Ddes_0052 WP_012623704.1.13825 WP_012623704.1.52045 gi|220903338|ref|YP_002478650.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]