SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525146.Ddes_0298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525146.Ddes_0298
Domain Number 1 Region: 786-1173
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.57e-129
Family PFOR PP module 0.000000000364
Further Details:      
 
Domain Number 2 Region: 414-666
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.81e-84
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000111
Further Details:      
 
Domain Number 3 Region: 4-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.41e-75
Family PFOR Pyr module 0.00000000787
Further Details:      
 
Domain Number 4 Region: 259-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000381
Further Details:      
 
Domain Number 5 Region: 664-831
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.86e-19
Family Ferredoxin domains from multidomain proteins 0.0000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 525146.Ddes_0298
Sequence length 1178
Comment (Desulfovibrio desulfuricans ATCC 27774)
Sequence
MAHMKTMDGNNATTHIAYALSETAAIYPITPSSVMGEVMDQMAAKGMKNLLGQKVIVREM
QSEAGAAGAVHGMLSAGALTSTYTASQGLLLMIPNMYKIAGELLPGVFHVSARALASHAL
SIFGDHQDVMAARQTGFCFLASASVQECMDLALVAHLSSIDSSLPFCHFFDGFRTSHEVQ
KIEVIDYEDIRGLVNWDKVDEFRATAMNPEHPHIRGTAQNPDIYFQNREASNLFYDAVPG
IVLENMKKVESITGRKYRLFDYVGHPEADRVIVSMGSSCEVAEETVNYLNSQGQRVGLVK
VRLYRPFSAEHLLRALPATTTCITVLDRTKESGALGDPLYQDVCTAFLEKGEAPTIVAGR
YGLGSKDFTPGMAKAVYDNMLGLQPKNHFTVGITDDVTNLSLEVEEEIDTVPAGTVQCKF
FGLGADGTVGANKQAIKIIGDNTDLYAQAYFAYDSKKSGGFTVSHLRFGKAPITSSYLIT
SADYVACHKSAYVTQYDILEGIKEGGTFVLNSNWSLADLEKHLPASMKRTIARKKLKFYN
VDAVKVAQEVGLGGRINMIMQTAFFKLANVLDFDKAVALLKESIKKTYGSKGDKIVNMNI
AAVDKGMDALEEIKYPATWANATEGAEVCHCDDDDYIRSVVRPILAQQGDKLPVSAMDPA
GFMPLGTAACEKRGVAIAIPEWQVENCIQCCQCSFVCPHAAIRPVLATEEELEGAPAAFA
TKDAMGKELKGLKFRIQVYPEDCLGCGSCADVCPAKNKALVMKPLETQMDDQKANLAFAE
AHVSLKDKLLARDTVKGSQLQQPLHEFSGACAGCGETPYVKVLTQLFGERMIVANATGCS
SIWGASSPTTPYCTNKDGFGPAWGNSLFEDAAEYGCGMGLAYDQRRNLLAMKIEEALKEE
GISSELKEAMEGWLANKDDAEGSRKYGDMVLANLDSFESPLAHEIWHMDDLFTKKSVWIF
GGDGWGYDIGYGGLDHVLATGDDINILLMDTEVYSNTGGQSSKATPLGAVAQFAAAGKRT
GKKDLGRMAMTYGYVYVASISMGADKQQTLKAFREAEAYKGPSLIIAYAPCINQGLRKGM
GKSQEESKLAVQTGYWPLYRYHPELAKEKKNPFQLDSKAPTVDIQEFLGGETRFASLEKT
DPEASKQLRAELADAYAERYALLKQLADLPYPDANETK
Download sequence
Identical sequences A0A1K1N5V8 B8J376
525146.Ddes_0298 gi|220903579|ref|YP_002478891.1| WP_012623943.1.13825 WP_012623943.1.52045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]