SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525897.Dbac_1044 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525897.Dbac_1044
Domain Number 1 Region: 785-1170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.07e-128
Family PFOR PP module 0.00000000017
Further Details:      
 
Domain Number 2 Region: 415-666
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-90
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000699
Further Details:      
 
Domain Number 3 Region: 3-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.41e-77
Family PFOR Pyr module 0.00000000607
Further Details:      
 
Domain Number 4 Region: 259-413
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000135
Further Details:      
 
Domain Number 5 Region: 663-830
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.55e-19
Family Ferredoxin domains from multidomain proteins 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 525897.Dbac_1044
Sequence length 1215
Comment (Desulfomicrobium baculatum DSM 4028)
Sequence
MAKNMKTMDGNTAVTHIAYAMSDTAAIYPITPSSTMGEIADEWAAQGRLNIFDQKVMVRQ
MQSEAGAAGAVHGSLAGGALTSTFTCSQGLLLMIPNMYKISGELLPGVFHVSARAVAAHA
LSIFGDHQDVMACRQTGFAMLASSSVQECMDLALVAHLSSIESSIPFLHFFDGFRSSHEI
QKIEVIDYEDIKKVVNHEAIAEFRERAMSPANPSIRGTAQNPDIYYQGREASNVYYDQLS
SIVVEQMKKVTSITGRSYKPFDYVGHPQAERVIVAMGSSCETIEEVVRHLLAKGEKVGLV
KVRLYRPFLPEYFLQVLPATASVITVLDRTKEPGAKGDPLYKDICTAYMERGEMPEIVAG
RYGLGSKEFTPAMVKAVYDNMMVAQPKHHFNVGIDDDVTHTSLDVPAFADTTPAGTVQCK
FWGLGSDGTVGANKEAIKIIGDNTDMYAQGYFAYDSKKSGGITVSHLRFGKEPIQSTYLV
NAADYIACHKASYVHTYDVLDGIKDGGTFVLNSNWTAEDMEKELPASMRRTIAKKNLKFY
NIDAVKIAAEAGLGNRINMVMQTAFFKLANVMPFEEAVALLKKAIKKAYGKKGDKIVNMN
IAAVDQASANLIEIKVPAAWADAACECATDQDVPDFVKNVMRPILAQKGDSLPVSAFEPD
GLFPVATSQFEKRGVAINVPEWIAANCIQCNQCSFVCPHAAIIPVLLTEEEMADAPETFE
TLDAIGKEFKGMKFRIQVNALDCMGCGNCADICPAKNTALVMKPLETQTGREVPNYDFSV
TVPFKDNLTRRDTVKGSQFQKPLMEFSGACAGCGETPYVKVMTQLFGERMIIANATGCSS
IWGASAPTTPYTVNADGHGPAWGNSLFEDAAEFGYGIQMAYAQRQAKLADLVAKALEGEL
PEDLAEAFKGWLENRANAEKCKEYGDNVRDILAFMHRDELLDAIYEREELFAKNSFWIFG
GDGWAYDIGYGGLDHVLASGEDINVLVMDTEVYSNTGGQSSKATPLGSIAKFAAAGKRTG
KKDLGRMVMSYGYVYVATVSMGYDKQQLLKALREAEAYPGPSLIIAYAPCINQGLRRGMG
KTQLESKLAVQSGYWPLYRFNPLLSEEGKNPFILDSKAPDGSIQEFLASENRYALLEKIA
PEDSKRLRTQIEQDYLQRFEMYEYLAKQEPTAGKAASAPVTVSAAAGEGCTLTATAEHAG
ANKPGLPCDDGRAGK
Download sequence
Identical sequences C7LQS8
WP_015773255.1.63071 gi|256828845|ref|YP_003157573.1| 525897.Dbac_1044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]